BLASTX nr result
ID: Jatropha_contig00009615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00009615 (389 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19... 62 1e-07 gb|EEE84854.2| hypothetical protein POPTR_0001s35270g, partial [... 57 3e-06 ref|XP_002300049.1| predicted protein [Populus trichocarpa] 57 3e-06 >gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19884.1| 16.6 kDa oleosin [Jatropha curcas] Length = 155 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 388 DIAKMRMQDMVGFLGQKTKEVGQVIQRKAHEGK 290 DIAK RMQDM GF+GQKTKEVGQ IQRKAHEGK Sbjct: 123 DIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 155 >gb|EEE84854.2| hypothetical protein POPTR_0001s35270g, partial [Populus trichocarpa] Length = 214 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 388 DIAKMRMQDMVGFLGQKTKEVGQVIQRKAHEGK 290 D AK RMQDM G++GQKTKEVGQ IQRKAH+GK Sbjct: 182 DQAKRRMQDMAGYVGQKTKEVGQEIQRKAHDGK 214 >ref|XP_002300049.1| predicted protein [Populus trichocarpa] Length = 149 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 388 DIAKMRMQDMVGFLGQKTKEVGQVIQRKAHEGK 290 D AK RMQDM G++GQKTKEVGQ IQRKAH+GK Sbjct: 117 DQAKRRMQDMAGYVGQKTKEVGQEIQRKAHDGK 149