BLASTX nr result
ID: Jatropha_contig00009527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00009527 (526 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 97 2e-18 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 91 1e-16 ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 59 3e-08 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/48 (93%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -3 Query: 152 HF-PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVXRLFGRHG 12 HF PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYV +LFGRHG Sbjct: 556 HFVPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 3 RAWTMSPEQSXYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 131 RAWTMSPEQS YIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD Sbjct: 42 RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 58.5 bits (140), Expect(2) = 3e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 165 FVTRPRLRVLWTLRPPAASGSKLAPYVG 248 F+TRPRLRVLWTLRPPA SGSKLAPYVG Sbjct: 11 FLTRPRLRVLWTLRPPATSGSKLAPYVG 38 Score = 25.0 bits (53), Expect(2) = 3e-08 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 134 MNKKENGTIGFCDSP 178 MNKKENGTI F P Sbjct: 1 MNKKENGTILFLTRP 15