BLASTX nr result
ID: Jatropha_contig00009312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00009312 (396 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511106.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002511106.1| conserved hypothetical protein [Ricinus communis] gi|223550221|gb|EEF51708.1| conserved hypothetical protein [Ricinus communis] Length = 555 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 396 RKLSIEQQLWEASRKEIDQPSYGSVANHKST 304 RKLSIEQQLWEASR+EIDQP+ GSVANHK T Sbjct: 519 RKLSIEQQLWEASRREIDQPTSGSVANHKRT 549