BLASTX nr result
ID: Jatropha_contig00008852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008852 (356 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putat... 65 9e-09 gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus t... 63 4e-08 ref|XP_002309184.1| predicted protein [Populus trichocarpa] gi|2... 63 4e-08 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus pe... 58 1e-06 ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1-like ... 56 5e-06 emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera] 56 5e-06 >ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis] gi|223531866|gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis] Length = 625 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLDNQGEIPVHHA RGDI Sbjct: 595 MDSEIRAIMAQYMPLDNQGEIPVHHAARGDI 625 >gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa] Length = 551 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLD+Q +IPVHHAPRGDI Sbjct: 521 MDSEIRAIMAQYMPLDSQADIPVHHAPRGDI 551 >ref|XP_002309184.1| predicted protein [Populus trichocarpa] gi|222855160|gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa] Length = 625 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLD+Q +IPVHHAPRGDI Sbjct: 595 MDSEIRAIMAQYMPLDSQADIPVHHAPRGDI 625 >gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica] Length = 625 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLDNQGEIP +H PRGDI Sbjct: 596 MDSEIRAIMAQYMPLDNQGEIP-NHVPRGDI 625 >ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1-like [Vitis vinifera] gi|297735537|emb|CBI18031.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLDNQGEIP +H P GDI Sbjct: 595 MDSEIRAIMAQYMPLDNQGEIP-NHVPHGDI 624 >emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera] Length = 625 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 284 MDSEIRAIMAQYMPLDNQGEIPVHHAPRGDI 192 MDSEIRAIMAQYMPLDNQGEIP +H P GDI Sbjct: 596 MDSEIRAIMAQYMPLDNQGEIP-NHVPHGDI 625