BLASTX nr result
ID: Jatropha_contig00008829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008829 (465 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525434.1| yth domain-containing protein, putative [Ric... 64 3e-08 >ref|XP_002525434.1| yth domain-containing protein, putative [Ricinus communis] gi|223535247|gb|EEF36924.1| yth domain-containing protein, putative [Ricinus communis] Length = 677 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -3 Query: 463 QKSMDSVLRESTGAASVEVGKMNGELKLLEENGSNSAVDNSPKIAKHVASSENKAVP*C 287 QKS DS+L+E AA+VE GK++GE++++E NGS ++V+NSP AK V SSE+K C Sbjct: 619 QKSTDSMLKEPVVAAAVESGKISGEVRVVEANGSGASVENSPNDAKSVVSSESKVASAC 677