BLASTX nr result
ID: Jatropha_contig00008372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008372 (549 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525972.1| nucleic acid binding protein, putative [Rici... 55 2e-07 >ref|XP_002525972.1| nucleic acid binding protein, putative [Ricinus communis] gi|223534704|gb|EEF36396.1| nucleic acid binding protein, putative [Ricinus communis] Length = 693 Score = 55.5 bits (132), Expect(2) = 2e-07 Identities = 32/77 (41%), Positives = 43/77 (55%) Frame = +2 Query: 122 KKIPSLGMETEDMIGLPAXXXXXXXXXXGEIHKSGFGSGEADSQPRNFEAEEDVGDGDSL 301 +K+ L METEDMI LP E+ + G GEA+SQP N+EAEE + DG ++ Sbjct: 32 EKVLILSMETEDMISLPDSTNSGDGIENNELDQPESGPGEAESQPSNYEAEEGMIDGHNM 91 Query: 302 RLNNDVDIDTEKGIRGP 352 L N+VDI + P Sbjct: 92 GL-NEVDIGNKTETSDP 107 Score = 25.0 bits (53), Expect(2) = 2e-07 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 360 LALVEDDTGAEKILGDSEVLDSNEDDIGTEEHVTRLEN 473 L L ++D GAE+ S+ + NE+++ TEE EN Sbjct: 110 LELNQNDFGAEECTKGSKDSELNEENVKTEECSAVQEN 147