BLASTX nr result
ID: Jatropha_contig00008370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008370 (352 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531731.1| conserved hypothetical protein [Ricinus comm... 94 2e-17 ref|XP_002531962.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002531731.1| conserved hypothetical protein [Ricinus communis] gi|223528634|gb|EEF30651.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 148 EAHGARPIADHKQKPLLRKVASEKLVKRLDPRRADPSKGISAVGR*KP 5 EAHGARPIADHKQKPLLRKVASEKLVKRLDPRRADPSKGISAVGR +P Sbjct: 5 EAHGARPIADHKQKPLLRKVASEKLVKRLDPRRADPSKGISAVGRSRP 52 >ref|XP_002531962.1| conserved hypothetical protein [Ricinus communis] gi|223528385|gb|EEF30423.1| conserved hypothetical protein [Ricinus communis] Length = 353 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +2 Query: 104 RLLFVVCDGSSPVSLSKRSQIGLFVVLLRA--YGTTAFIIPLSQNVEQRIESLSLCPHSF 277 RLLFVVCDGSSPVSLSK SQI LFVV++ Y FIIP SQN R+ + P ++ Sbjct: 117 RLLFVVCDGSSPVSLSKHSQISLFVVVVTGIQYYGLYFIIPFSQN--WRLTPTEIAPKNY 174