BLASTX nr result
ID: Jatropha_contig00008356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008356 (630 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531337.1| DNA binding protein, putative [Ricinus commu... 40 4e-07 gb|AAR14274.1| predicted protein [Populus tremula x Populus alba] 41 9e-07 ref|XP_002273013.1| PREDICTED: uncharacterized protein LOC100246... 39 3e-06 emb|CBI32607.3| unnamed protein product [Vitis vinifera] 39 3e-06 ref|XP_002877934.1| predicted protein [Arabidopsis lyrata subsp.... 40 4e-06 >ref|XP_002531337.1| DNA binding protein, putative [Ricinus communis] gi|223529059|gb|EEF31044.1| DNA binding protein, putative [Ricinus communis] Length = 856 Score = 40.4 bits (93), Expect(2) = 4e-07 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 615 ILGSLNVVNLVLPAAEEAESIGTRKIWLQK 526 +L SLNVV LVLPAAEEAESI TR+ +K Sbjct: 794 LLCSLNVVKLVLPAAEEAESIWTRRFGFRK 823 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 517 EGQLSKYTRELQGTIFKGTTMLEE 446 E QLS+YTRELQ TIFKGT+MLE+ Sbjct: 826 EEQLSQYTRELQLTIFKGTSMLEK 849 >gb|AAR14274.1| predicted protein [Populus tremula x Populus alba] Length = 868 Score = 40.8 bits (94), Expect(2) = 9e-07 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -3 Query: 520 AEGQLSKYTRELQGTIFKGTTMLEE 446 +EGQL KYTRE Q TIFKGT+MLE+ Sbjct: 836 SEGQLLKYTREFQLTIFKGTSMLEK 860 Score = 38.1 bits (87), Expect(2) = 9e-07 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 615 ILGSLNVVNLVLPAAEEAESIGTRKIWLQK 526 +L SLNV LVLPAAEEAESI TR+ +K Sbjct: 805 LLCSLNVEQLVLPAAEEAESIWTRRFGFRK 834 >ref|XP_002273013.1| PREDICTED: uncharacterized protein LOC100246491 [Vitis vinifera] Length = 896 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 618 EILGSLNVVNLVLPAAEEAESIGTRKIWLQK 526 E+L SL V LVLPAAEEAE+I T K+ QK Sbjct: 833 ELLSSLGVKTLVLPAAEEAEAIWTNKLGFQK 863 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = -3 Query: 538 LASER*AEGQLSKYTRELQGTIFKGTTMLEE 446 L ++ +E ++ KYTRELQ TIFKGT+MLE+ Sbjct: 859 LGFQKMSEERMLKYTRELQLTIFKGTSMLEK 889 >emb|CBI32607.3| unnamed protein product [Vitis vinifera] Length = 841 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 618 EILGSLNVVNLVLPAAEEAESIGTRKIWLQK 526 E+L SL V LVLPAAEEAE+I T K+ QK Sbjct: 778 ELLSSLGVKTLVLPAAEEAEAIWTNKLGFQK 808 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = -3 Query: 538 LASER*AEGQLSKYTRELQGTIFKGTTMLEE 446 L ++ +E ++ KYTRELQ TIFKGT+MLE+ Sbjct: 804 LGFQKMSEERMLKYTRELQLTIFKGTSMLEK 834 >ref|XP_002877934.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323772|gb|EFH54193.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 834 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 615 ILGSLNVVNLVLPAAEEAESIGTRKIWLQK 526 +L SLNV NL+LPAAEEAESI T+K K Sbjct: 767 LLSSLNVENLLLPAAEEAESIWTKKFGFTK 796 Score = 37.0 bits (84), Expect(2) = 4e-06 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 517 EGQLSKYTRELQGTIFKGTTMLEER 443 E QL KY RE+Q TIFKGT+MLE++ Sbjct: 799 EHQLQKYQREVQLTIFKGTSMLEKK 823