BLASTX nr result
ID: Jatropha_contig00008350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008350 (164 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus t... 65 1e-08 ref|XP_002324578.1| predicted protein [Populus trichocarpa] 64 2e-08 gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus t... 62 1e-07 >gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] Length = 83 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -3 Query: 141 ALRQAGFTEQRSHPAPGSGRITGRCHLDPHDPMGRSNWTITF 16 A R+AG TEQRS PAPGSGRITGRC LD H SNWT+TF Sbjct: 39 AQREAGLTEQRSPPAPGSGRITGRCQLDLHGLKSWSNWTVTF 80 >ref|XP_002324578.1| predicted protein [Populus trichocarpa] Length = 84 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 23 MVQLDRPIGSCGSKWHRPVILPLPGAGCDRCSVKPA*RSAVLYRTR 160 MVQLD+ C S+WHRPVILPLPGAG DRCSV+PA R A+ R++ Sbjct: 1 MVQLDQLFKPCRSRWHRPVILPLPGAGGDRCSVRPASRCALPSRSQ 46 >gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 141 ALRQAGFTEQRSHPAPGSGRITGRCHLDPHDPMG 40 A R+AG TEQRS PAPGSGRITGRCHLDPH MG Sbjct: 39 AQREAGLTEQRSLPAPGSGRITGRCHLDPHGLMG 72