BLASTX nr result
ID: Jatropha_contig00008044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008044 (149 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162796.1| PREDICTED: uncharacterized protein LOC101232... 57 3e-06 >ref|XP_004162796.1| PREDICTED: uncharacterized protein LOC101232191 [Cucumis sativus] Length = 293 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 24 QRILSVARWELYFKAALAARPPRGLGQRHVPLGAGWPLLRVG 149 QRIL +ARW+L +KA A P RGL QRHVPLGA PLL VG Sbjct: 203 QRILPIARWKLRYKATPATHPSRGLCQRHVPLGAKRPLLLVG 244