BLASTX nr result
ID: Jatropha_contig00008042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00008042 (121 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR66584.1| hypothetical protein CICLE_v10007405mg [Citrus cl... 58 1e-06 ref|XP_002324467.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-06 >gb|ESR66584.1| hypothetical protein CICLE_v10007405mg [Citrus clementina] Length = 888 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 2 LSSFAALVLLPKSSKYDKSNERTFRGRDGVILLFNAADPV 121 +SSFAAL LLP+SS ++N TF+GRDGVILLFNA DPV Sbjct: 706 MSSFAALALLPESSNCKEANGTTFQGRDGVILLFNAVDPV 745 >ref|XP_002324467.1| predicted protein [Populus trichocarpa] gi|222865901|gb|EEF03032.1| transducin family protein [Populus trichocarpa] Length = 811 Score = 55.8 bits (133), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +2 Query: 2 LSSFAALVLLPKSSKYDKSNERTFRGRDGVILLFNAADPV 121 +SSFA L LLP+SSK NE +F+GRDGVILLFNAADPV Sbjct: 632 ISSFAVLALLPESSK---CNETSFKGRDGVILLFNAADPV 668