BLASTX nr result
ID: Jatropha_contig00007897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007897 (140 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 64 2e-08 gb|EPS74712.1| hypothetical protein M569_00037, partial [Genlise... 59 5e-07 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = -3 Query: 138 SPFPHGTCTLSVIEEYLGLEGGSPFLRVKAIRIRTRRVLXGKDRTM 1 SPFPHGTCTLSVIEEYLGLEGG PF R T R GKDRTM Sbjct: 888 SPFPHGTCTLSVIEEYLGLEGGPPFSRKSDQNSNTPR-FTGKDRTM 932 >gb|EPS74712.1| hypothetical protein M569_00037, partial [Genlisea aurea] Length = 68 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/45 (68%), Positives = 31/45 (68%) Frame = -3 Query: 138 SPFPHGTCTLSVIEEYLGLEGGSPFLRVKAIRIRTRRVLXGKDRT 4 SPFPHGTCTLSVIEEYLG EGG PF R T R GKDRT Sbjct: 5 SPFPHGTCTLSVIEEYLGNEGGPPFSRKSDQNSNTPR-FTGKDRT 48