BLASTX nr result
ID: Jatropha_contig00007770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007770 (264 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523433.1| ganglioside induced differentiation associat... 68 1e-09 ref|XP_006348716.1| PREDICTED: protein GDAP2 homolog [Solanum tu... 66 5e-09 ref|XP_006344250.1| PREDICTED: protein GDAP2 homolog [Solanum tu... 66 5e-09 gb|ESW29418.1| hypothetical protein PHAVU_002G069100g [Phaseolus... 66 5e-09 gb|ESR52027.1| hypothetical protein CICLE_v10033452mg [Citrus cl... 66 5e-09 gb|EEE89642.2| appr-1-p processing enzyme family protein [Populu... 66 5e-09 gb|EEF01185.2| appr-1-p processing enzyme family protein [Populu... 66 5e-09 ref|XP_004983001.1| PREDICTED: protein GDAP2 homolog [Setaria it... 66 5e-09 gb|EOY01780.1| Appr-1-p processing enzyme family protein isoform... 66 5e-09 ref|XP_004514238.1| PREDICTED: protein GDAP2 homolog isoform X1 ... 66 5e-09 ref|XP_004490144.1| PREDICTED: protein GDAP2 homolog isoform X2 ... 66 5e-09 ref|XP_004297263.1| PREDICTED: protein GDAP2 homolog [Fragaria v... 66 5e-09 gb|EMJ26758.1| hypothetical protein PRUPE_ppa003605m1g [Prunus p... 66 5e-09 ref|XP_004239077.1| PREDICTED: protein GDAP2 homolog isoform 1 [... 66 5e-09 ref|XP_004237051.1| PREDICTED: protein GDAP2 homolog [Solanum ly... 66 5e-09 gb|AFK47574.1| unknown [Lotus japonicus] 66 5e-09 gb|AFK44101.1| unknown [Lotus japonicus] 66 5e-09 ref|XP_003613998.1| Ganglioside-induced differentiation-associat... 66 5e-09 ref|XP_002315014.1| predicted protein [Populus trichocarpa] 66 5e-09 ref|XP_002312275.1| predicted protein [Populus trichocarpa] 66 5e-09 >ref|XP_002523433.1| ganglioside induced differentiation associated protein, putative [Ricinus communis] gi|223537323|gb|EEF38953.1| ganglioside induced differentiation associated protein, putative [Ricinus communis] Length = 561 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FRHVPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRHVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552 >ref|XP_006348716.1| PREDICTED: protein GDAP2 homolog [Solanum tuberosum] Length = 556 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 516 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 547 >ref|XP_006344250.1| PREDICTED: protein GDAP2 homolog [Solanum tuberosum] Length = 556 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 516 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 547 >gb|ESW29418.1| hypothetical protein PHAVU_002G069100g [Phaseolus vulgaris] gi|561030840|gb|ESW29419.1| hypothetical protein PHAVU_002G069100g [Phaseolus vulgaris] Length = 561 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552 >gb|ESR52027.1| hypothetical protein CICLE_v10033452mg [Citrus clementina] Length = 573 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 533 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 564 >gb|EEE89642.2| appr-1-p processing enzyme family protein [Populus trichocarpa] Length = 561 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552 >gb|EEF01185.2| appr-1-p processing enzyme family protein [Populus trichocarpa] Length = 561 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552 >ref|XP_004983001.1| PREDICTED: protein GDAP2 homolog [Setaria italica] Length = 577 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 534 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 565 >gb|EOY01780.1| Appr-1-p processing enzyme family protein isoform 1 [Theobroma cacao] Length = 559 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 519 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 550 >ref|XP_004514238.1| PREDICTED: protein GDAP2 homolog isoform X1 [Cicer arietinum] gi|502167743|ref|XP_004514239.1| PREDICTED: protein GDAP2 homolog isoform X2 [Cicer arietinum] gi|502167746|ref|XP_004514240.1| PREDICTED: protein GDAP2 homolog isoform X3 [Cicer arietinum] Length = 560 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 520 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 551 >ref|XP_004490144.1| PREDICTED: protein GDAP2 homolog isoform X2 [Cicer arietinum] Length = 560 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 520 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 551 >ref|XP_004297263.1| PREDICTED: protein GDAP2 homolog [Fragaria vesca subsp. vesca] Length = 562 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 522 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 553 >gb|EMJ26758.1| hypothetical protein PRUPE_ppa003605m1g [Prunus persica] Length = 562 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 522 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 553 >ref|XP_004239077.1| PREDICTED: protein GDAP2 homolog isoform 1 [Solanum lycopersicum] Length = 556 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 516 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 547 >ref|XP_004237051.1| PREDICTED: protein GDAP2 homolog [Solanum lycopersicum] Length = 557 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 517 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 548 >gb|AFK47574.1| unknown [Lotus japonicus] Length = 166 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 126 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 157 >gb|AFK44101.1| unknown [Lotus japonicus] Length = 166 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 126 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 157 >ref|XP_003613998.1| Ganglioside-induced differentiation-associated protein [Medicago truncatula] gi|355515333|gb|AES96956.1| Ganglioside-induced differentiation-associated protein [Medicago truncatula] Length = 560 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 520 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 551 >ref|XP_002315014.1| predicted protein [Populus trichocarpa] Length = 561 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552 >ref|XP_002312275.1| predicted protein [Populus trichocarpa] Length = 561 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 263 FRHVPREQLTIPDFVFQHDVEVSGGKGLIVDP 168 FR+VPREQLTIPDFVFQHD+EV+GGKGLIVDP Sbjct: 521 FRYVPREQLTIPDFVFQHDLEVNGGKGLIVDP 552