BLASTX nr result
ID: Jatropha_contig00007713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007713 (103 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 75 1e-11 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 67 3e-09 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 101 RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSY 3 RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSY Sbjct: 42 RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSY 74 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 VRRENTRSHSDLDMWNRLAPYVLRLFGRHG 92 VRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 574 VRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603