BLASTX nr result
ID: Jatropha_contig00007504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007504 (230 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU05450.1| hypothetical protein CAPTEDRAFT_103064, partial [... 55 3e-07 ref|XP_005792707.1| hypothetical protein EMIHUDRAFT_77663, parti... 55 7e-06 ref|XP_005773285.1| hypothetical protein EMIHUDRAFT_75086, parti... 55 7e-06 >gb|ELU05450.1| hypothetical protein CAPTEDRAFT_103064, partial [Capitella teleta] Length = 123 Score = 55.1 bits (131), Expect(2) = 3e-07 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 221 SSKLSLKGNFGGNQLLDGSISLSPPIPKQTNDLHV 117 SS +GNFGGNQLLDGSISLSP P QTNDLHV Sbjct: 44 SSSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHV 78 Score = 25.0 bits (53), Expect(2) = 3e-07 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 51 GPDRHASSNPFRN-KVGR 1 GPDR+A SNP + KVGR Sbjct: 84 GPDRYAHSNPSQKIKVGR 101 >ref|XP_005792707.1| hypothetical protein EMIHUDRAFT_77663, partial [Emiliania huxleyi CCMP1516] gi|485647028|gb|EOD40278.1| hypothetical protein EMIHUDRAFT_77663, partial [Emiliania huxleyi CCMP1516] Length = 98 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 203 KGNFGGNQLLDGSISLSPPIPKQTNDLHVSI 111 +GNFGGNQLLDGSISLSP P TNDLHVSI Sbjct: 52 EGNFGGNQLLDGSISLSPLYPDSTNDLHVSI 82 >ref|XP_005773285.1| hypothetical protein EMIHUDRAFT_75086, partial [Emiliania huxleyi CCMP1516] gi|551575125|ref|XP_005773289.1| hypothetical protein EMIHUDRAFT_75089, partial [Emiliania huxleyi CCMP1516] gi|551620830|ref|XP_005790931.1| hypothetical protein EMIHUDRAFT_70248, partial [Emiliania huxleyi CCMP1516] gi|485624888|gb|EOD20856.1| hypothetical protein EMIHUDRAFT_75086, partial [Emiliania huxleyi CCMP1516] gi|485624892|gb|EOD20860.1| hypothetical protein EMIHUDRAFT_75089, partial [Emiliania huxleyi CCMP1516] gi|485644564|gb|EOD38502.1| hypothetical protein EMIHUDRAFT_70248, partial [Emiliania huxleyi CCMP1516] Length = 101 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 203 KGNFGGNQLLDGSISLSPPIPKQTNDLHVSI 111 +GNFGGNQLLDGSISLSP P TNDLHVSI Sbjct: 55 EGNFGGNQLLDGSISLSPLYPDSTNDLHVSI 85