BLASTX nr result
ID: Jatropha_contig00007424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007424 (366 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|22... 98 1e-18 ref|XP_004304422.1| PREDICTED: probable E3 ubiquitin-protein lig... 96 4e-18 gb|ERP59258.1| hypothetical protein POPTR_0006s13060g [Populus t... 95 8e-18 ref|XP_002326350.1| predicted protein [Populus trichocarpa] 95 8e-18 gb|EMJ06652.1| hypothetical protein PRUPE_ppa007885mg [Prunus pe... 95 1e-17 ref|XP_004295026.1| PREDICTED: probable E3 ubiquitin-protein lig... 92 7e-17 gb|EEF05226.2| hypothetical protein POPTR_0016s09050g [Populus t... 91 1e-16 ref|XP_002323465.1| predicted protein [Populus trichocarpa] 91 1e-16 ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein lig... 91 2e-16 gb|ACA35276.1| zinc finger RING-type protein [Cucumis sativus] 91 2e-16 gb|EMJ06596.1| hypothetical protein PRUPE_ppa007468mg [Prunus pe... 90 3e-16 ref|NP_001064306.1| Os10g0204100 [Oryza sativa Japonica Group] g... 90 3e-16 gb|EEC66689.1| hypothetical protein OsI_32999 [Oryza sativa Indi... 90 3e-16 ref|XP_006361815.1| PREDICTED: probable E3 ubiquitin-protein lig... 89 4e-16 ref|XP_004246663.1| PREDICTED: probable E3 ubiquitin-protein lig... 89 4e-16 gb|ESR37831.1| hypothetical protein CICLE_v10028818mg [Citrus cl... 89 7e-16 ref|XP_003558324.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 89 7e-16 dbj|BAJ86959.1| predicted protein [Hordeum vulgare subsp. vulgar... 89 7e-16 ref|XP_002465537.1| hypothetical protein SORBIDRAFT_01g040770 [S... 89 7e-16 gb|EMT24069.1| RING finger protein 157 [Aegilops tauschii] 88 1e-15 >ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|223541406|gb|EEF42957.1| mahogunin, putative [Ricinus communis] Length = 306 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLRY TNRCPICRQPVERLLEIKVNNG DE Sbjct: 262 VLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKVNNGPDE 306 >ref|XP_004304422.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Fragaria vesca subsp. vesca] Length = 360 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLRY TNRCPICRQPVERLLEIKVNNG +E Sbjct: 316 VLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKVNNGPEE 360 >gb|ERP59258.1| hypothetical protein POPTR_0006s13060g [Populus trichocarpa] Length = 357 Score = 95.1 bits (235), Expect = 8e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPV+RLLEIKVNNG DE Sbjct: 313 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIKVNNGPDE 357 >ref|XP_002326350.1| predicted protein [Populus trichocarpa] Length = 284 Score = 95.1 bits (235), Expect = 8e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPV+RLLEIKVNNG DE Sbjct: 240 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIKVNNGPDE 284 >gb|EMJ06652.1| hypothetical protein PRUPE_ppa007885mg [Prunus persica] Length = 352 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPVERLLEIKVNNG +E Sbjct: 308 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVNNGLEE 352 >ref|XP_004295026.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Fragaria vesca subsp. vesca] Length = 371 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTD 235 VLPCRHMCMCSGCAKVLR+ TNRCP+CRQPVERLLEIKVNN D Sbjct: 324 VLPCRHMCMCSGCAKVLRFQTNRCPVCRQPVERLLEIKVNNAAD 367 >gb|EEF05226.2| hypothetical protein POPTR_0016s09050g [Populus trichocarpa] Length = 352 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICR PV+RLLEIKVNN DE Sbjct: 308 VLPCRHMCMCSGCAKVLRFQTNRCPICRHPVDRLLEIKVNNAPDE 352 >ref|XP_002323465.1| predicted protein [Populus trichocarpa] Length = 283 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICR PV+RLLEIKVNN DE Sbjct: 239 VLPCRHMCMCSGCAKVLRFQTNRCPICRHPVDRLLEIKVNNAPDE 283 >ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] gi|449513666|ref|XP_004164388.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] Length = 368 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPV+RLLEI+V+NG +E Sbjct: 323 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIRVSNGPEE 367 >gb|ACA35276.1| zinc finger RING-type protein [Cucumis sativus] Length = 300 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPV+RLLEI+V+NG +E Sbjct: 255 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIRVSNGPEE 299 >gb|EMJ06596.1| hypothetical protein PRUPE_ppa007468mg [Prunus persica] Length = 366 Score = 89.7 bits (221), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNN 244 VLPCRHMCMCSGCAKVLR+ TNRCP+CRQPVERLLEIKVNN Sbjct: 320 VLPCRHMCMCSGCAKVLRFQTNRCPVCRQPVERLLEIKVNN 360 >ref|NP_001064306.1| Os10g0204100 [Oryza sativa Japonica Group] gi|19225030|gb|AAL86506.1|AC099040_10 putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica Group] gi|20279471|gb|AAM18751.1|AC099325_7 unknown protein [Oryza sativa Japonica Group] gi|31430853|gb|AAP52712.1| RING zinc finger protein, putative, expressed [Oryza sativa Japonica Group] gi|113638915|dbj|BAF26220.1| Os10g0204100 [Oryza sativa Japonica Group] gi|222612586|gb|EEE50718.1| hypothetical protein OsJ_31005 [Oryza sativa Japonica Group] Length = 425 Score = 89.7 bits (221), Expect = 3e-16 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY TNRCPICRQPVERLLEIKVNN +E Sbjct: 355 VLPCRHMCMCSECAKVLRYQTNRCPICRQPVERLLEIKVNNKGEE 399 >gb|EEC66689.1| hypothetical protein OsI_32999 [Oryza sativa Indica Group] Length = 425 Score = 89.7 bits (221), Expect = 3e-16 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY TNRCPICRQPVERLLEIKVNN +E Sbjct: 355 VLPCRHMCMCSECAKVLRYQTNRCPICRQPVERLLEIKVNNKGEE 399 >ref|XP_006361815.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Solanum tuberosum] Length = 363 Score = 89.4 bits (220), Expect = 4e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPVERLLEIKV+ G E Sbjct: 318 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVSEGAAE 362 >ref|XP_004246663.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Solanum lycopersicum] Length = 362 Score = 89.4 bits (220), Expect = 4e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCSGCAKVLR+ TNRCPICRQPVERLLEIKV+ G E Sbjct: 317 VLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVSEGAAE 361 >gb|ESR37831.1| hypothetical protein CICLE_v10028818mg [Citrus clementina] Length = 330 Score = 88.6 bits (218), Expect = 7e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVL++ TNRCPICRQPVERLLEIKVNN D+ Sbjct: 286 VLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD 330 >ref|XP_003558324.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Brachypodium distachyon] Length = 405 Score = 88.6 bits (218), Expect = 7e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY T RCPICRQPVERLLEIKVNN ++E Sbjct: 339 VLPCRHMCMCSECAKVLRYQTTRCPICRQPVERLLEIKVNNKSEE 383 >dbj|BAJ86959.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326519695|dbj|BAK00220.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533240|dbj|BAJ93592.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 407 Score = 88.6 bits (218), Expect = 7e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY T RCPICRQPVERLLEIKVNN ++E Sbjct: 341 VLPCRHMCMCSECAKVLRYQTTRCPICRQPVERLLEIKVNNKSEE 385 >ref|XP_002465537.1| hypothetical protein SORBIDRAFT_01g040770 [Sorghum bicolor] gi|241919391|gb|EER92535.1| hypothetical protein SORBIDRAFT_01g040770 [Sorghum bicolor] Length = 402 Score = 88.6 bits (218), Expect = 7e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY T RCPICRQPVERLLEIKVNN ++E Sbjct: 338 VLPCRHMCMCSECAKVLRYQTTRCPICRQPVERLLEIKVNNKSEE 382 >gb|EMT24069.1| RING finger protein 157 [Aegilops tauschii] Length = 277 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 366 VLPCRHMCMCSGCAKVLRYPTNRCPICRQPVERLLEIKVNNGTDE 232 VLPCRHMCMCS CAKVLRY T RCPICRQPVERLLEIKVNN +E Sbjct: 211 VLPCRHMCMCSECAKVLRYQTTRCPICRQPVERLLEIKVNNKAEE 255