BLASTX nr result
ID: Jatropha_contig00007325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007325 (227 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX19661.1| cysteine proteinase [Populus tomentosa] 138 6e-31 ref|XP_002512963.1| cysteine protease, putative [Ricinus communi... 137 1e-30 ref|XP_002313770.1| predicted protein [Populus trichocarpa] gi|2... 137 1e-30 gb|ABK92536.1| unknown [Populus trichocarpa] 137 1e-30 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trich... 136 3e-30 ref|XP_002305451.1| predicted protein [Populus trichocarpa] 136 3e-30 emb|CAE54306.1| putative papain-like cysteine proteinase [Gossyp... 135 4e-30 dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas] 134 9e-30 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao] 133 3e-29 ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]... 133 3e-29 ref|NP_001241450.1| uncharacterized protein LOC100778716 precurs... 132 3e-29 gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoaca... 132 3e-29 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao] 132 6e-29 ref|XP_004290288.1| PREDICTED: cysteine proteinase RD19a-like [F... 132 6e-29 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus cl... 131 8e-29 ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Gly... 131 8e-29 gb|ESW32697.1| hypothetical protein PHAVU_001G009900g [Phaseolus... 131 1e-28 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus... 131 1e-28 ref|XP_002510469.1| cysteine protease, putative [Ricinus communi... 131 1e-28 dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris] 131 1e-28 >gb|AAX19661.1| cysteine proteinase [Populus tomentosa] Length = 374 Score = 138 bits (348), Expect = 6e-31 Identities = 65/75 (86%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLT AEF+KQ LGLR LRLPKDA++APILPTNDLPEDFDWREKGAV VKNQGSC Sbjct: 104 VTQFSDLTSAEFRKQVLGLRKLRLPKDANKAPILPTNDLPEDFDWREKGAVGPVKNQGSC 163 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 164 GSCWSFSTTGALEGA 178 >ref|XP_002512963.1| cysteine protease, putative [Ricinus communis] gi|223547974|gb|EEF49466.1| cysteine protease, putative [Ricinus communis] Length = 373 Score = 137 bits (346), Expect = 1e-30 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLT +EF++QFLGLR LRLPKDA++AP+LPTNDLP DFDWREKGAVT VKNQGSC Sbjct: 103 VTQFSDLTHSEFRRQFLGLRRLRLPKDANEAPMLPTNDLPADFDWREKGAVTAVKNQGSC 162 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 163 GSCWSFSTTGALEGA 177 >ref|XP_002313770.1| predicted protein [Populus trichocarpa] gi|222850178|gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa] Length = 368 Score = 137 bits (346), Expect = 1e-30 Identities = 65/75 (86%), Positives = 68/75 (90%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLT AEF+KQ LGLR LRLPKDA+ APILPTNDLPEDFDWREKGAV VKNQGSC Sbjct: 98 VTQFSDLTSAEFRKQVLGLRKLRLPKDANTAPILPTNDLPEDFDWREKGAVGPVKNQGSC 157 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 158 GSCWSFSTTGALEGA 172 >gb|ABK92536.1| unknown [Populus trichocarpa] Length = 368 Score = 137 bits (346), Expect = 1e-30 Identities = 65/75 (86%), Positives = 68/75 (90%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLT AEF+KQ LGLR LRLPKDA+ APILPTNDLPEDFDWREKGAV VKNQGSC Sbjct: 98 VTQFSDLTSAEFRKQVLGLRKLRLPKDANTAPILPTNDLPEDFDWREKGAVGPVKNQGSC 157 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 158 GSCWSFSTTGALEGA 172 >gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa] Length = 368 Score = 136 bits (342), Expect = 3e-30 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLTPAEF+KQ LGLR LRLPKDA++APILPT+DLPEDFDWR+KGAV +KNQGSC Sbjct: 98 VTQFSDLTPAEFRKQVLGLRRLRLPKDANEAPILPTSDLPEDFDWRDKGAVGPIKNQGSC 157 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFS TGALEGA Sbjct: 158 GSCWSFSATGALEGA 172 >ref|XP_002305451.1| predicted protein [Populus trichocarpa] Length = 368 Score = 136 bits (342), Expect = 3e-30 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLTPAEF+KQ LGLR LRLPKDA++APILPT+DLPEDFDWR+KGAV +KNQGSC Sbjct: 98 VTQFSDLTPAEFRKQVLGLRRLRLPKDANEAPILPTSDLPEDFDWRDKGAVGPIKNQGSC 157 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFS TGALEGA Sbjct: 158 GSCWSFSATGALEGA 172 >emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum] Length = 373 Score = 135 bits (341), Expect = 4e-30 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLTP EF+K +LGLR LRLPKDA +APILPT++LP+DFDWREKGAVT VKNQGSC Sbjct: 103 VTQFSDLTPGEFRKAYLGLRRLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSC 162 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 163 GSCWSFSTTGALEGA 177 >dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas] Length = 368 Score = 134 bits (338), Expect = 9e-30 Identities = 60/75 (80%), Positives = 66/75 (88%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + FSDLTP EF++Q+LGLR LRLP DAH+APILPTNDLP DFDWR+ GAVTNVKNQGSC Sbjct: 97 VTMFSDLTPREFRRQYLGLRRLRLPADAHEAPILPTNDLPTDFDWRDHGAVTNVKNQGSC 156 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFS GALEGA Sbjct: 157 GSCWSFSAAGALEGA 171 >gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao] Length = 395 Score = 133 bits (334), Expect = 3e-29 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLTP EF++ +LGLR LRLPKDA +APILPT++LPEDFDW EKGAVT VKNQGSC Sbjct: 125 VTQFSDLTPREFRRTYLGLRRLRLPKDATEAPILPTDNLPEDFDWSEKGAVTPVKNQGSC 184 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 185 GSCWSFSTTGALEGA 199 >ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera] gi|161778780|gb|ABX79341.1| cysteine protease [Vitis vinifera] Length = 377 Score = 133 bits (334), Expect = 3e-29 Identities = 61/75 (81%), Positives = 67/75 (89%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + QFSDLTPAEF+ +LGLR L+LP DA +APILPTNDLPEDFDWR+ GAVT VKNQGSC Sbjct: 107 VTQFSDLTPAEFRGTYLGLRPLKLPHDAQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSC 166 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 167 GSCWSFSTTGALEGA 181 >ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max] gi|255639509|gb|ACU20049.1| unknown [Glycine max] Length = 366 Score = 132 bits (333), Expect = 3e-29 Identities = 60/75 (80%), Positives = 66/75 (88%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF++QFLGL+ LRLP DA +APILPTNDLP DFDWRE GAVT VKNQGSC Sbjct: 96 VTRFSDLTPAEFRRQFLGLKPLRLPSDAQKAPILPTNDLPTDFDWREHGAVTGVKNQGSC 155 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFS GALEGA Sbjct: 156 GSCWSFSAVGALEGA 170 >gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia] Length = 335 Score = 132 bits (333), Expect = 3e-29 Identities = 58/75 (77%), Positives = 71/75 (94%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTP+EF++QFLGL+ LRLP+ A +APILPT+DLPEDFDWR+KGAVT+VKNQGSC Sbjct: 67 VTKFSDLTPSEFRRQFLGLKPLRLPEHAQKAPILPTHDLPEDFDWRDKGAVTHVKNQGSC 126 Query: 181 GSCWSFSTTGALEGA 225 GSCW+FSTTGALEG+ Sbjct: 127 GSCWAFSTTGALEGS 141 >gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao] Length = 401 Score = 132 bits (331), Expect = 6e-29 Identities = 59/75 (78%), Positives = 68/75 (90%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTP+EF++QFLGLR L+LP DA +APILPTNDLP DFDWR+ GAVT VK+QGSC Sbjct: 131 VTKFSDLTPSEFRRQFLGLRPLKLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGSC 190 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 191 GSCWSFSTTGALEGA 205 >ref|XP_004290288.1| PREDICTED: cysteine proteinase RD19a-like [Fragaria vesca subsp. vesca] Length = 372 Score = 132 bits (331), Expect = 6e-29 Identities = 60/75 (80%), Positives = 67/75 (89%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF+K LGLR L+LP DA+ APILPT +LPEDFDWRE+GAVT VKNQGSC Sbjct: 105 VTRFSDLTPAEFRKSHLGLRGLKLPADANTAPILPTENLPEDFDWRERGAVTEVKNQGSC 164 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 165 GSCWSFSTTGALEGA 179 >gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina] Length = 375 Score = 131 bits (330), Expect = 8e-29 Identities = 63/76 (82%), Positives = 68/76 (89%), Gaps = 1/76 (1%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLR-SLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGS 177 + QFSDLTPAEF++ +LGLR LRLPKDA QAPILPTNDLP DFDWREKGAV VK+QGS Sbjct: 105 VTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGS 164 Query: 178 CGSCWSFSTTGALEGA 225 CGSCWSFSTTGALEGA Sbjct: 165 CGSCWSFSTTGALEGA 180 >ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max] Length = 367 Score = 131 bits (330), Expect = 8e-29 Identities = 58/75 (77%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF++QFLG + LRLP +A +APILPT DLP+DFDWR+KGAVTNVK+QG+C Sbjct: 98 VTKFSDLTPAEFRRQFLGFKPLRLPANAQKAPILPTKDLPKDFDWRDKGAVTNVKDQGAC 157 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 158 GSCWSFSTTGALEGA 172 >gb|ESW32697.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris] Length = 292 Score = 131 bits (329), Expect = 1e-28 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF ++FLGL+ LRLP A +APILPTN+LP+DFDWR+KGAVTNVK+QGSC Sbjct: 96 VTKFSDLTPAEFHRKFLGLKPLRLPAHAQKAPILPTNNLPKDFDWRDKGAVTNVKDQGSC 155 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 156 GSCWSFSTTGALEGA 170 >gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris] Length = 365 Score = 131 bits (329), Expect = 1e-28 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF ++FLGL+ LRLP A +APILPTN+LP+DFDWR+KGAVTNVK+QGSC Sbjct: 96 VTKFSDLTPAEFHRKFLGLKPLRLPAHAQKAPILPTNNLPKDFDWRDKGAVTNVKDQGSC 155 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 156 GSCWSFSTTGALEGA 170 >ref|XP_002510469.1| cysteine protease, putative [Ricinus communis] gi|223551170|gb|EEF52656.1| cysteine protease, putative [Ricinus communis] Length = 366 Score = 131 bits (329), Expect = 1e-28 Identities = 57/75 (76%), Positives = 67/75 (89%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTP EF++Q+LGL+ LRLP DAH+APILPT+ +PEDFDWR+ GAVTNVKNQGSC Sbjct: 96 VTKFSDLTPREFRRQYLGLKKLRLPADAHEAPILPTDGIPEDFDWRDHGAVTNVKNQGSC 155 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFS GALEGA Sbjct: 156 GSCWSFSAAGALEGA 170 >dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris] Length = 365 Score = 131 bits (329), Expect = 1e-28 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = +1 Query: 1 IPQFSDLTPAEFKKQFLGLRSLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSC 180 + +FSDLTPAEF ++FLGL+ LRLP A +APILPTN+LP+DFDWR+KGAVTNVK+QGSC Sbjct: 96 VTKFSDLTPAEFHRKFLGLKPLRLPAHAQKAPILPTNNLPKDFDWRDKGAVTNVKDQGSC 155 Query: 181 GSCWSFSTTGALEGA 225 GSCWSFSTTGALEGA Sbjct: 156 GSCWSFSTTGALEGA 170