BLASTX nr result
ID: Jatropha_contig00007302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007302 (677 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526981.1| ctp synthase, putative [Ricinus communis] gi... 72 2e-10 gb|EEE78707.2| CTP synthase family protein [Populus trichocarpa] 57 4e-06 ref|XP_002303728.1| predicted protein [Populus trichocarpa] 57 4e-06 >ref|XP_002526981.1| ctp synthase, putative [Ricinus communis] gi|223533672|gb|EEF35408.1| ctp synthase, putative [Ricinus communis] Length = 158 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = -2 Query: 676 GQLDSLLQGHRVLSGIGNGNGIAIPEVNVCQNGNVAKFAKIAADGMYTNFNGVH 515 GQLD++LQ H+V +GI NG I I +VNV QNG+ +KFA+IAADG+YTN NGVH Sbjct: 106 GQLDAILQSHKVPNGISNG--IPIQKVNVYQNGHASKFARIAADGIYTNCNGVH 157 >gb|EEE78707.2| CTP synthase family protein [Populus trichocarpa] Length = 604 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -2 Query: 673 QLDSLLQGHRVLSGIGNGNGIAIPEVNVCQNGNVAKFAKIAADGMYTNFNGVH 515 QLDSLL H++ +G+ ++++CQNGN KFAKI DG+Y+N NGVH Sbjct: 558 QLDSLLHAHKIPNGMAK-------KISLCQNGNATKFAKIPTDGIYSNCNGVH 603 >ref|XP_002303728.1| predicted protein [Populus trichocarpa] Length = 595 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -2 Query: 673 QLDSLLQGHRVLSGIGNGNGIAIPEVNVCQNGNVAKFAKIAADGMYTNFNGVH 515 QLDSLL H++ +G+ ++++CQNGN KFAKI DG+Y+N NGVH Sbjct: 549 QLDSLLHAHKIPNGMAK-------KISLCQNGNATKFAKIPTDGIYSNCNGVH 594