BLASTX nr result
ID: Jatropha_contig00007160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007160 (477 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, ... 56 5e-06 >ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] gi|223528266|gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] Length = 436 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 475 GSSNWSTSGGIFSPVALDPISPQGESAGVTFQASKVKS 362 GSSN STSGGIF PVA PISPQG S + FQASKV+S Sbjct: 387 GSSNSSTSGGIFPPVAFGPISPQGGSTSLRFQASKVQS 424