BLASTX nr result
ID: Jatropha_contig00007077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00007077 (251 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522854.1| sweet protein mabinlin-1 chain A [Ricinus co... 70 4e-10 prf||1707274A 2S albumin 69 8e-10 ref|XP_002522851.1| 2S albumin precursor, putative [Ricinus comm... 67 3e-09 ref|XP_002522847.1| 2S albumin precursor, putative [Ricinus comm... 60 4e-07 ref|XP_002522848.1| 2S albumin precursor, putative [Ricinus comm... 59 6e-07 ref|XP_002522852.1| 2S albumin precursor, putative [Ricinus comm... 56 4e-06 >ref|XP_002522854.1| sweet protein mabinlin-1 chain A [Ricinus communis] gi|255563707|ref|XP_002522855.1| sweet protein mabinlin-1, chain B [Ricinus communis] gi|112762|sp|P01089.2|2SS_RICCO RecName: Full=2S albumin; AltName: Allergen=Ric c 1/3; Contains: RecName: Full=Allergen Ric c 3 small chain; AltName: Full=4.7 kDa napin-like protein small chain; AltName: Full=CB-1A small chain; AltName: Full=RS1A; Contains: RecName: Full=Allergen Ric c 3 large chain; AltName: Full=CB-1A large chain; AltName: Full=RL1; Contains: RecName: Full=Allergen Ric c 1 small chain; AltName: Full=2S albumin small chain; AltName: Full=4 kDa napin-like protein small chain; AltName: Full=RS2B; Contains: RecName: Full=Allergen Ric c 1 large chain; AltName: Full=2S albumin large chain; AltName: Full=7.3 kDa napin-like protein large chain; AltName: Full=RL2; Flags: Precursor gi|21068|emb|CAA38097.1| 2S albumin precursor [Ricinus communis] gi|223537938|gb|EEF39552.1| sweet protein mabinlin-1 chain A [Ricinus communis] gi|223537939|gb|EEF39553.1| sweet protein mabinlin-1, chain B [Ricinus communis] Length = 258 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/79 (49%), Positives = 52/79 (65%), Gaps = 8/79 (10%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSSNVRD-----ICKKEAERRDLSS 67 MA LI + AL+ VLL IIANA YRT ITT+E+D+S R+ C++E +R+DLSS Sbjct: 1 MAKLIPTIALVSVLLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKDLSS 60 Query: 66 CENYITQ---RRGRSEDML 19 CE Y+ Q RR E++L Sbjct: 61 CERYLRQSSSRRSPGEEVL 79 >prf||1707274A 2S albumin Length = 258 Score = 68.6 bits (166), Expect = 8e-10 Identities = 38/79 (48%), Positives = 51/79 (64%), Gaps = 8/79 (10%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSSNVRD-----ICKKEAERRDLSS 67 MA LI + AL+ V L IIANA YRT ITT+E+D+S R+ C++E +R+DLSS Sbjct: 1 MAKLIPTIALVSVFLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKDLSS 60 Query: 66 CENYITQ---RRGRSEDML 19 CE Y+ Q RR E++L Sbjct: 61 CERYLRQSSSRRSTGEEVL 79 >ref|XP_002522851.1| 2S albumin precursor, putative [Ricinus communis] gi|223537935|gb|EEF39549.1| 2S albumin precursor, putative [Ricinus communis] Length = 179 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 5/71 (7%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSSNVRD-----ICKKEAERRDLSS 67 MA L+++ AL VLL IIA+A +RT ITT+E+DDS R+ C++E +R+DLSS Sbjct: 1 MAKLVSTIALFSVLLFIIADASFAHRTTITTIEIDDSKGEREGSHPQQCRQEIQRKDLSS 60 Query: 66 CENYITQRRGR 34 CE YI Q R Sbjct: 61 CEQYIRQSSSR 71 >ref|XP_002522847.1| 2S albumin precursor, putative [Ricinus communis] gi|223537931|gb|EEF39545.1| 2S albumin precursor, putative [Ricinus communis] Length = 152 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSSNVRDICKKEAERRDLSSCENYI 52 MA LI + AL+ VLL IIANA YRT ITTVEVDD +N ++ C ++ ++ +C+ Y+ Sbjct: 1 MAKLIPAVALISVLLFIIANASFAYRTTITTVEVDD-TNTQERCFRDLRGKEFRACQMYL 59 Query: 51 TQRRGR 34 +Q R Sbjct: 60 SQSSSR 65 >ref|XP_002522848.1| 2S albumin precursor, putative [Ricinus communis] gi|223537932|gb|EEF39546.1| 2S albumin precursor, putative [Ricinus communis] Length = 172 Score = 58.9 bits (141), Expect = 6e-07 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 7/76 (9%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSSNVR-------DICKKEAERRDL 73 MA LI + AL+ VLLVIIANA Y T TTVEVDD++ R + C++E E +DL Sbjct: 1 MAKLIPTVALISVLLVIIANASFAYTTATTTVEVDDTNPSRTGIWSPSENCRQELEGKDL 60 Query: 72 SSCENYITQRRGRSED 25 S+C Y+ S D Sbjct: 61 SACLMYVAASSRTSTD 76 >ref|XP_002522852.1| 2S albumin precursor, putative [Ricinus communis] gi|223537936|gb|EEF39550.1| 2S albumin precursor, putative [Ricinus communis] Length = 258 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/79 (45%), Positives = 47/79 (59%), Gaps = 8/79 (10%) Frame = -3 Query: 231 MANLITSTALLCVLLVIIANAVTGYRTIITTVEVDDSS-----NVRDICKKEAERRDLSS 67 MA LI + L+ VLLVIIANA Y T T+E+DD+ + C +E +R+DLSS Sbjct: 1 MAKLIPTVTLISVLLVIIANASFAYGT---TIEIDDTKAGGEGSRSQQCHQEFQRKDLSS 57 Query: 66 CENYITQ---RRGRSEDML 19 CE YI Q RR E++L Sbjct: 58 CEQYIRQSSSRRSPGEELL 76