BLASTX nr result
ID: Jatropha_contig00006913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006913 (368 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS96440.1| metallothionein-like protein [Jatropha curcas] 63 3e-08 >gb|ACS96440.1| metallothionein-like protein [Jatropha curcas] Length = 77 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 368 TLIAGVAPSKNLNESSDMSFGSEGGHGCKCGS 273 TLIAGVAPSK LNESS+MS G+EGGHGCKCGS Sbjct: 37 TLIAGVAPSKKLNESSEMSIGAEGGHGCKCGS 68