BLASTX nr result
ID: Jatropha_contig00006674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006674 (427 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC66278.1| secreted saposin-like protein SAP-3 [Fasciola gig... 96 4e-18 >gb|ABC66278.1| secreted saposin-like protein SAP-3 [Fasciola gigantica] Length = 102 Score = 96.3 bits (238), Expect = 4e-18 Identities = 49/58 (84%), Positives = 50/58 (86%) Frame = -1 Query: 307 CTVALDQLKKLLQIDAVRNEVEVLMKGVCAAFGPVKGLCEALVGKGIRYCLRFHTEAK 134 CTVALDQLKKLLQIDAVRNEVEVLMKGVCAAFGPVKGLCEALVGKGI F + K Sbjct: 34 CTVALDQLKKLLQIDAVRNEVEVLMKGVCAAFGPVKGLCEALVGKGIDIVFDFIQKQK 91 Score = 48.9 bits (115), Expect(2) = 4e-09 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 165 DIVFDFIQKQKSQDICAKIRLC 100 DIVFDFIQKQKSQDICAKIRLC Sbjct: 81 DIVFDFIQKQKSQDICAKIRLC 102 Score = 37.4 bits (85), Expect(2) = 4e-09 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 350 QFQEPDADVSPCEVLHCSLGSIEK 279 QFQEPDADVSPCEV +L ++K Sbjct: 20 QFQEPDADVSPCEVCTVALDQLKK 43