BLASTX nr result
ID: Jatropha_contig00006426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006426 (433 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511147.1| Protein HVA22, putative [Ricinus communis] g... 60 4e-07 >ref|XP_002511147.1| Protein HVA22, putative [Ricinus communis] gi|223550262|gb|EEF51749.1| Protein HVA22, putative [Ricinus communis] Length = 114 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/75 (50%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = -1 Query: 400 YTVKLAFVLGCLA--H*RSAFIYERYVRENIKKYTGVRDXXXXXXXXXXXXXXXXXXXXK 227 YTVKL V + +AFIYE+YVREN+KKY G RD K Sbjct: 42 YTVKLVLVAWLVLPQFRGAAFIYEKYVRENLKKYRGGRD--RHHSPHTSPNVSSGKGKNK 99 Query: 226 FVQFITPKKGEHEAY 182 FVQFITPKKGEHEAY Sbjct: 100 FVQFITPKKGEHEAY 114