BLASTX nr result
ID: Jatropha_contig00006375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006375 (488 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL39729.1| NAC transcription factor 073 [Jatropha curcas] 72 5e-11 >gb|AGL39729.1| NAC transcription factor 073 [Jatropha curcas] Length = 375 Score = 72.4 bits (176), Expect = 5e-11 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = -3 Query: 486 VLFEPEVSLKSAVFLLIGTEECLSAQLVLSTSLPSGTGSQIGAIP 352 VLFEPEVSLKSAVFL IGTEECLS LSTSLPSGTGSQIGAIP Sbjct: 332 VLFEPEVSLKSAVFLPIGTEECLS-HSSLSTSLPSGTGSQIGAIP 375