BLASTX nr result
ID: Jatropha_contig00006332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006332 (447 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521293.1| nascent polypeptide associated complex alpha... 42 3e-06 >ref|XP_002521293.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223539478|gb|EEF41067.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 228 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 275 TKPGVSRSHMAVKALRTHNGDIVSAIMELT 186 T+ GV RS AVKAL+TH+GDIVSAIMELT Sbjct: 199 TQAGVPRSK-AVKALKTHSGDIVSAIMELT 227 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -3 Query: 406 PDMASVLPKSDISGAAVLHRQTKKRKKL 323 PDMASVLPKSD+SGAA + ++ +++ Sbjct: 157 PDMASVLPKSDLSGAAAAAQADEEEEEV 184