BLASTX nr result
ID: Jatropha_contig00006162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00006162 (267 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 57 3e-06 ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 55 9e-06 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 6 EKQAKELAFGVSEREVDQAFGRQNEEWFFPVPRRGSFEGHAVA 134 +++AKELA+GV +EVDQ FG+Q EE+FFP PRR EG A A Sbjct: 502 DREAKELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 6 EKQAKELAFGVSEREVDQAFGRQNEEWFFPVPRRGSFEGHAVA 134 E++AKELAFGV REVD+ F QNE +FFP PRR ++G A A Sbjct: 518 EREAKELAFGVRAREVDEVFESQNEVFFFPGPRRQEWQGRASA 560