BLASTX nr result
ID: Jatropha_contig00005859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005859 (200 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19... 61 9e-08 >gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19884.1| 16.6 kDa oleosin [Jatropha curcas] Length = 155 Score = 60.8 bits (146), Expect(2) = 9e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 95 SCFKGHQKGPSAQKVLAVITLLPVSGGLLALTGIT 199 + FKG QKGPSAQKVLAVITLLPV GGLLAL GIT Sbjct: 20 AAFKGQQKGPSAQKVLAVITLLPVGGGLLALAGIT 54 Score = 20.8 bits (42), Expect(2) = 9e-08 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 39 MAERSXXXXXXXXXXXRYEAASKVTKK 119 MAERS RYEAA K +K Sbjct: 1 MAERSQPHQVQVHPQHRYEAAFKGQQK 27