BLASTX nr result
ID: Jatropha_contig00005857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005857 (322 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518211.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002518211.1| conserved hypothetical protein [Ricinus communis] gi|223542807|gb|EEF44344.1| conserved hypothetical protein [Ricinus communis] Length = 159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 321 SSRNGPGYRYTEYALGAVGEPIPKGGTAVTGTRV 220 SSR GPGYR T+Y +GA GEP+PKGG VTGTRV Sbjct: 126 SSRYGPGYRDTDYGVGAGGEPMPKGGVPVTGTRV 159