BLASTX nr result
ID: Jatropha_contig00005841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005841 (140 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 58 1e-06 emb|CBI28721.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptid... 56 4e-06 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 138 INEEGNTRHLRAGINNIVNKMEKQAKELAFGVSEREVDQAFGRQNE 1 +N +GN R+ AG NNIV + E++AKELAFGV REVD+ F QNE Sbjct: 497 VNAQGNIRYTLAGRNNIVRRWEREAKELAFGVRAREVDEVFESQNE 542 >emb|CBI28721.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -3 Query: 138 INEEGNTRHLRAGINNIVNKMEKQAKELAFGVSEREVDQAFGRQNE 1 +N E N R AG NIVN +EK+AKELAF + REVD+ F +QNE Sbjct: 340 VNAENNRRESLAGDKNIVNALEKEAKELAFSIPAREVDEVFAKQNE 385 >ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 562 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -3 Query: 138 INEEGNTRHLRAGINNIVNKMEKQAKELAFGVSEREVDQAFGRQNE 1 +N E N R AG NIVN +EK+AKELAF + REVD+ F +QNE Sbjct: 503 VNAENNRRESLAGDKNIVNALEKEAKELAFSIPAREVDEVFAKQNE 548