BLASTX nr result
ID: Jatropha_contig00005774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005774 (295 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510715.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002510715.1| conserved hypothetical protein [Ricinus communis] gi|223551416|gb|EEF52902.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +2 Query: 125 PSIWVSKHQISPNFVEIRREFVLSHGQLRWNPPVTNPLFQLRAINDSVS-AEDEQRP 292 P +W+SK ++SP F+EIRREFVLSH Q++ N TNP LRA SV+ EDEQ P Sbjct: 33 PLMWISKPRLSPKFMEIRREFVLSHYQIKLNRSFTNP---LRASKGSVNPTEDEQTP 86