BLASTX nr result
ID: Jatropha_contig00005730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005730 (279 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19... 61 1e-07 >gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19884.1| 16.6 kDa oleosin [Jatropha curcas] Length = 155 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 188 QEVTRRMPEQLDIAKKRMQDMAGFVGQKTQ 99 QEVTRRMPEQLDIAKKRMQDMAGFVGQKT+ Sbjct: 112 QEVTRRMPEQLDIAKKRMQDMAGFVGQKTK 141