BLASTX nr result
ID: Jatropha_contig00005648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005648 (562 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY05315.1| Cyclin dependent kinase inhibitor, putative [Theo... 69 8e-10 ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor... 68 2e-09 ref|XP_002518110.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 gb|EMJ24946.1| hypothetical protein PRUPE_ppa010514mg [Prunus pe... 64 2e-08 ref|XP_002323769.1| kip-related cyclin-dependent kinase inhibito... 64 3e-08 ref|XP_003556336.1| PREDICTED: cyclin-dependent kinase inhibitor... 63 5e-08 gb|AAV76001.1| cyclin dependent kinase inhibitor [Euphorbia esula] 62 7e-08 gb|ESW16145.1| hypothetical protein PHAVU_007G133100g [Phaseolus... 62 9e-08 gb|AHA84152.1| cyclin-dependent kinase inhibitor [Phaseolus vulg... 62 9e-08 ref|XP_004171801.1| PREDICTED: cyclin-dependent kinase inhibitor... 62 9e-08 ref|XP_004134001.1| PREDICTED: cyclin-dependent kinase inhibitor... 62 9e-08 ref|XP_004138956.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 2e-07 emb|CBI17323.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 2e-07 emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] 61 2e-07 gb|ESR34123.1| hypothetical protein CICLE_v10005793mg [Citrus cl... 61 2e-07 gb|ERP66367.1| hypothetical protein POPTR_0001s32120g [Populus t... 61 2e-07 ref|XP_006360356.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 4e-07 gb|ESQ51852.1| hypothetical protein EUTSA_v10017093mg [Eutrema s... 59 8e-07 ref|NP_001233980.1| p27KIP1-related-protein 1 [Solanum lycopersi... 59 1e-06 >gb|EOY05315.1| Cyclin dependent kinase inhibitor, putative [Theobroma cacao] Length = 264 Score = 68.9 bits (167), Expect = 8e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AEEEQQR FIEKYN DPVNDKPL GRYEWEK+DP Sbjct: 231 AEEEQQRQFIEKYNFDPVNDKPLPGRYEWEKVDP 264 >ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Fragaria vesca subsp. vesca] Length = 219 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AEEEQQ+ FI+KYN DPVNDKPL GRYEWEKLDP Sbjct: 186 AEEEQQKQFIDKYNFDPVNDKPLPGRYEWEKLDP 219 >ref|XP_002518110.1| conserved hypothetical protein [Ricinus communis] gi|223542706|gb|EEF44243.1| conserved hypothetical protein [Ricinus communis] Length = 266 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AEEEQQ+ FIEKYN DPVNDKPL+GRYEW KLDP Sbjct: 233 AEEEQQKRFIEKYNFDPVNDKPLAGRYEWAKLDP 266 >gb|EMJ24946.1| hypothetical protein PRUPE_ppa010514mg [Prunus persica] Length = 247 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AE EQQR FI KYN DPVNDKPL GRYEWEK+DP Sbjct: 214 AEGEQQRQFIAKYNFDPVNDKPLPGRYEWEKVDP 247 >ref|XP_002323769.1| kip-related cyclin-dependent kinase inhibitor 1 [Populus trichocarpa] gi|222866771|gb|EEF03902.1| hypothetical protein POPTR_0017s08120g [Populus trichocarpa] Length = 244 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AEEEQ R F EKYN DPV+DKPL GRYEWEKLDP Sbjct: 211 AEEEQLRQFTEKYNFDPVSDKPLPGRYEWEKLDP 244 >ref|XP_003556336.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Glycine max] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 558 EEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 EE QQ+ FIEKYN DPVN+KPLSGRYEWEKL P Sbjct: 192 EEAQQKKFIEKYNFDPVNEKPLSGRYEWEKLKP 224 >gb|AAV76001.1| cyclin dependent kinase inhibitor [Euphorbia esula] Length = 234 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AE EQQR F+E YN DPVN+KPL GRYEWEKLDP Sbjct: 201 AELEQQRQFMENYNFDPVNEKPLPGRYEWEKLDP 234 >gb|ESW16145.1| hypothetical protein PHAVU_007G133100g [Phaseolus vulgaris] Length = 226 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 558 EEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 EE QQR FIEKYN DPVN+KPL GRYEWEKL P Sbjct: 194 EEAQQRKFIEKYNFDPVNEKPLPGRYEWEKLKP 226 >gb|AHA84152.1| cyclin-dependent kinase inhibitor [Phaseolus vulgaris] Length = 226 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 558 EEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 EE QQR FIEKYN DPVN+KPL GRYEWEKL P Sbjct: 194 EEAQQRKFIEKYNFDPVNEKPLPGRYEWEKLKP 226 >ref|XP_004171801.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Cucumis sativus] Length = 265 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AE EQQR FIEKYN DP+ DKPL GRYEWEKLD Sbjct: 232 AEGEQQRKFIEKYNFDPITDKPLPGRYEWEKLD 264 >ref|XP_004134001.1| PREDICTED: cyclin-dependent kinase inhibitor 4-like [Cucumis sativus] Length = 248 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AE EQQR FIEKYN DP+ DKPL GRYEWEKLD Sbjct: 215 AEGEQQRKFIEKYNFDPITDKPLPGRYEWEKLD 247 >ref|XP_004138956.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Cucumis sativus] gi|449525071|ref|XP_004169543.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Cucumis sativus] Length = 261 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 AEE+QQR FIEKYN DPV D PL GRYEWEKL P Sbjct: 228 AEEKQQRHFIEKYNFDPVKDTPLPGRYEWEKLQP 261 >emb|CBI17323.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AEEEQQR+F +KYN DPVNDKPLSGR+EW KL+ Sbjct: 170 AEEEQQRVFTDKYNFDPVNDKPLSGRFEWVKLN 202 >ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Vitis vinifera] Length = 263 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AEEEQQR+F +KYN DPVNDKPLSGR+EW KL+ Sbjct: 230 AEEEQQRVFTDKYNFDPVNDKPLSGRFEWVKLN 262 >emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] Length = 252 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AEEEQQR+F +KYN DPVNDKPLSGR+EW KL+ Sbjct: 219 AEEEQQRVFTDKYNFDPVNDKPLSGRFEWVKLN 251 >gb|ESR34123.1| hypothetical protein CICLE_v10005793mg [Citrus clementina] Length = 231 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 558 EEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLDP 460 EEEQQR FIEKYN DPVNDKPL G ++W+K+DP Sbjct: 199 EEEQQRQFIEKYNYDPVNDKPLPGHFKWQKVDP 231 >gb|ERP66367.1| hypothetical protein POPTR_0001s32120g [Populus trichocarpa] Length = 248 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AEEEQ R F EKYN DPV+DKPL GRYEWEKLD Sbjct: 215 AEEEQLRQFTEKYNFDPVSDKPLHGRYEWEKLD 247 >ref|XP_006360356.1| PREDICTED: cyclin-dependent kinase inhibitor 4-like [Solanum tuberosum] Length = 209 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AE+EQQR FIEKYN DPVNDKPL GRYEW K++ Sbjct: 176 AEKEQQRKFIEKYNFDPVNDKPLPGRYEWVKVN 208 >gb|ESQ51852.1| hypothetical protein EUTSA_v10017093mg [Eutrema salsugineum] Length = 264 Score = 58.9 bits (141), Expect = 8e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AEEEQQ+ FIEKYN DPVN++PL GR+EW+K+D Sbjct: 231 AEEEQQKQFIEKYNFDPVNEQPLPGRFEWKKVD 263 >ref|NP_001233980.1| p27KIP1-related-protein 1 [Solanum lycopersicum] gi|23899378|emb|CAD29648.1| p27KIP1-related-protein 1 [Solanum lycopersicum] Length = 210 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 561 AEEEQQRLFIEKYNLDPVNDKPLSGRYEWEKLD 463 AE+EQQR FIEKYN DPVN+KPL GRYEW K++ Sbjct: 177 AEKEQQRKFIEKYNFDPVNEKPLPGRYEWVKVN 209