BLASTX nr result
ID: Jatropha_contig00005646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005646 (362 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511068.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_002511068.1| conserved hypothetical protein [Ricinus communis] gi|223550183|gb|EEF51670.1| conserved hypothetical protein [Ricinus communis] Length = 160 Score = 55.8 bits (133), Expect = 5e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 347 VQEFDSGLQSLPDANIHRDAFAY-KPHAETLKSVGIDPKRH 228 +QEFDSGLQS PD +I RDAFA+ P E+LKSVGIDPK H Sbjct: 121 IQEFDSGLQSFPD-HIQRDAFAHDNPRVESLKSVGIDPKLH 160