BLASTX nr result
ID: Jatropha_contig00005504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005504 (254 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532206.1| NOI, putative [Ricinus communis] gi|22352810... 59 5e-07 >ref|XP_002532206.1| NOI, putative [Ricinus communis] gi|223528102|gb|EEF30175.1| NOI, putative [Ricinus communis] Length = 77 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 14 KPDSPARDNSSFKPGSNTLVKTSXLRKWFCCIQAAPAE 127 KPDSPA+DNS +KPG+ TL K +KWFCCIQ+APAE Sbjct: 41 KPDSPAKDNSGYKPGTTTLGKPQS-KKWFCCIQSAPAE 77