BLASTX nr result
ID: Jatropha_contig00005418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005418 (382 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 64 3e-08 emb|CBI28721.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptid... 61 1e-07 ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 60 2e-07 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 366 VNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 226 + +M+++AKELA+GV +EVDQ FG+Q EE+FFPGPRR EG A A Sbjct: 498 IGEMDREAKELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544 >emb|CBI28721.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 366 VNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 250 VN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 357 VNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 395 >ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 562 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 366 VNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 250 VN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 520 VNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 558 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 366 VNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 226 V + E++AKELAFGV REVD+ F QNE +FFPGPRR ++G A A Sbjct: 514 VRRWEREAKELAFGVRAREVDEVFESQNEVFFFPGPRRQEWQGRASA 560