BLASTX nr result
ID: Jatropha_contig00005404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005404 (400 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876892.1| hypothetical protein ARALYDRAFT_904655 [Arab... 59 6e-07 >ref|XP_002876892.1| hypothetical protein ARALYDRAFT_904655 [Arabidopsis lyrata subsp. lyrata] gi|297322730|gb|EFH53151.1| hypothetical protein ARALYDRAFT_904655 [Arabidopsis lyrata subsp. lyrata] Length = 74 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 150 SGSSRKTMKAPGKDGRIFRDEFEKDPAAYFRNNRGK 257 SG ++KTMKAPGKDGRIFR+ FE DP YFRN R K Sbjct: 39 SGPNKKTMKAPGKDGRIFREVFESDPKGYFRNMRNK 74