BLASTX nr result
ID: Jatropha_contig00005322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005322 (391 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531259.1| RNA binding protein, putative [Ricinus commu... 56 4e-06 >ref|XP_002531259.1| RNA binding protein, putative [Ricinus communis] gi|223529144|gb|EEF31123.1| RNA binding protein, putative [Ricinus communis] Length = 174 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = -3 Query: 389 EDKERRNKQRRSSIVEDVEGKKLWLDGKKE---ERFGSEK 279 EDKER NK+R+SSIV+D EGKK WLD KK+ ERFG+EK Sbjct: 106 EDKERMNKERKSSIVDDGEGKKHWLDDKKKMKNERFGNEK 145