BLASTX nr result
ID: Jatropha_contig00005301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005301 (132 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524198.1| legumin B precursor, putative [Ricinus commu... 57 2e-06 ref|XP_002524195.1| legumin B precursor, putative [Ricinus commu... 57 2e-06 >ref|XP_002524198.1| legumin B precursor, putative [Ricinus communis] gi|8118510|gb|AAF73007.1|AF262998_1 legumin-like protein [Ricinus communis] gi|223536567|gb|EEF38213.1| legumin B precursor, putative [Ricinus communis] Length = 476 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 6 PLEVIANAFRVSREDAMRIKFGREETTLGTSRFSTCRK 119 P+EVIANAFRVS E+A RIKF REETTLG+SRF + R+ Sbjct: 435 PVEVIANAFRVSIEEARRIKFAREETTLGSSRFQSGRR 472 >ref|XP_002524195.1| legumin B precursor, putative [Ricinus communis] gi|223536564|gb|EEF38210.1| legumin B precursor, putative [Ricinus communis] Length = 476 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 6 PLEVIANAFRVSREDAMRIKFGREETTLGTSRFSTCRK 119 P+EVIANAFRVS E+A RIKF REETTLG+SRF + R+ Sbjct: 435 PVEVIANAFRVSIEEARRIKFAREETTLGSSRFQSGRR 472