BLASTX nr result
ID: Jatropha_contig00005250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005250 (376 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF00673.2| Ca+2-binding EF hand family protein [Populus tric... 58 1e-06 ref|XP_004147185.1| PREDICTED: peroxygenase-like [Cucumis sativu... 56 4e-06 >gb|EEF00673.2| Ca+2-binding EF hand family protein [Populus trichocarpa] Length = 239 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 376 EEGFLSKEAVRRCLIDSLFEYCAKMNMGSESKM 278 EEGFLSKEA+RRC SLFEYCAKMN G+E+KM Sbjct: 206 EEGFLSKEAIRRCFDGSLFEYCAKMNRGAEAKM 238 >ref|XP_004147185.1| PREDICTED: peroxygenase-like [Cucumis sativus] gi|449498636|ref|XP_004160591.1| PREDICTED: peroxygenase-like [Cucumis sativus] gi|164449275|gb|ABY56103.1| caleosin [Cucumis sativus] Length = 239 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 376 EEGFLSKEAVRRCLIDSLFEYCAKMNMGSESKMY 275 E+G+LSKEAVRRC SLFEYCAKMNM ++ KMY Sbjct: 206 EDGYLSKEAVRRCYDGSLFEYCAKMNMSAQYKMY 239