BLASTX nr result
ID: Jatropha_contig00005188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005188 (444 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF04428.2| hypothetical protein POPTR_0016s04670g [Populus t... 59 8e-07 gb|ERP51536.1| hypothetical protein POPTR_0016s04570g [Populus t... 59 8e-07 ref|XP_002322667.1| predicted protein [Populus trichocarpa] 59 8e-07 gb|AFN53709.1| hypothetical protein [Linum usitatissimum] 57 2e-06 >gb|EEF04428.2| hypothetical protein POPTR_0016s04670g [Populus trichocarpa] Length = 196 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 342 QMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGD 443 QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGD Sbjct: 127 QMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGD 159 >gb|ERP51536.1| hypothetical protein POPTR_0016s04570g [Populus trichocarpa] Length = 208 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 342 QMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGD 443 QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGD Sbjct: 139 QMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGD 171 >ref|XP_002322667.1| predicted protein [Populus trichocarpa] Length = 175 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 342 QMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGD 443 QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGD Sbjct: 106 QMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGD 138 >gb|AFN53709.1| hypothetical protein [Linum usitatissimum] Length = 163 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 342 QMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGD 443 QMSAMPGHGTGQPYGG VD G+ R PSGLPG+ Sbjct: 113 QMSAMPGHGTGQPYGGHVD-EGVARVHPSGLPGE 145