BLASTX nr result
ID: Jatropha_contig00005167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005167 (122 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus... 65 7e-09 gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus cl... 65 7e-09 gb|EPS57537.1| hypothetical protein M569_17280, partial [Genlise... 65 7e-09 gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma ca... 65 7e-09 ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [C... 65 7e-09 ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arieti... 65 7e-09 gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba] 65 7e-09 ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like is... 65 7e-09 ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [G... 65 7e-09 ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [G... 65 7e-09 ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycin... 65 7e-09 ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycin... 65 7e-09 ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycin... 65 7e-09 ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus... 65 7e-09 ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus... 65 7e-09 gb|ABK93207.1| unknown [Populus trichocarpa] 65 7e-09 ref|XP_002309361.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; ... 65 7e-09 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] 65 7e-09 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus... 64 1e-08 >gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina] Length = 182 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >gb|EPS57537.1| hypothetical protein M569_17280, partial [Genlisea aurea] Length = 75 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 25 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 57 >gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao] Length = 257 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 76 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 108 >ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum] gi|502156356|ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|502158502|ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|24817256|emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba] Length = 182 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like isoform 2 [Glycine max] Length = 169 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 176 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max] gi|356517806|ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|356556759|ref|XP_003546690.1| PREDICTED: 60S ribosomal protein L11-like isoform 1 [Glycine max] gi|255627231|gb|ACU13960.1| unknown [Glycine max] gi|255648308|gb|ACU24606.1| unknown [Glycine max] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max] gi|255627001|gb|ACU13845.1| unknown [Glycine max] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max] gi|255626957|gb|ACU13823.1| unknown [Glycine max] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223551092|gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223538487|gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >gb|ABK93207.1| unknown [Populus trichocarpa] Length = 180 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >ref|XP_002309361.1| predicted protein [Populus trichocarpa] gi|224091827|ref|XP_002309362.1| predicted protein [Populus trichocarpa] gi|224116812|ref|XP_002317400.1| predicted protein [Populus trichocarpa] gi|224116816|ref|XP_002317401.1| predicted protein [Populus trichocarpa] gi|118483608|gb|ABK93699.1| unknown [Populus trichocarpa] gi|222855337|gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa] gi|222855338|gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa] gi|222860465|gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa] gi|222860466|gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa] Length = 180 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 gi|463252|emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] Length = 181 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 33 >gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris] Length = 181 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 21 MASEKKLSNPMREIKVQKLVLNISVGESGDRLT 119 MA+EKKLSNPMREIKVQKLVLNISVGESGDRLT Sbjct: 1 MAAEKKLSNPMREIKVQKLVLNISVGESGDRLT 33