BLASTX nr result
ID: Jatropha_contig00005150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005150 (552 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517584.1| Late embryogenesis abundant protein D-7, put... 66 5e-09 >ref|XP_002517584.1| Late embryogenesis abundant protein D-7, putative [Ricinus communis] gi|223543216|gb|EEF44748.1| Late embryogenesis abundant protein D-7, putative [Ricinus communis] Length = 130 Score = 66.2 bits (160), Expect = 5e-09 Identities = 42/96 (43%), Positives = 54/96 (56%), Gaps = 11/96 (11%) Frame = -1 Query: 537 VKEKAGEAKDWT-----------GVKAHETRVXXXXXXXXXXXXXXXXXXXXKGVLEETG 391 VKE+A EA+D T KAHETR KGV+++TG Sbjct: 28 VKERAREARDKTYETGQHAKENTAEKAHETREKASETAEAAKDKTYEGKEKTKGVVQQTG 87 Query: 390 EKMKHAAQKTADTVKSAFGMAHHEEEEDHVKDRSGH 283 +K+K+ AQKTADTVKSAFGMAH+ E+ KD++GH Sbjct: 88 DKVKNMAQKTADTVKSAFGMAHNGED----KDKAGH 119