BLASTX nr result
ID: Jatropha_contig00005097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00005097 (473 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532957.1| conserved hypothetical protein [Ricinus comm... 66 3e-10 >ref|XP_002532957.1| conserved hypothetical protein [Ricinus communis] gi|223527267|gb|EEF29423.1| conserved hypothetical protein [Ricinus communis] Length = 834 Score = 66.2 bits (160), Expect(2) = 3e-10 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = -2 Query: 373 RNFCKHGIPNMHLQ-KFFRASLGLRXXXXXXXXKRCTLETQYLIKEQLLESNCFSSEVGP 197 + +H I NM L KFFRASLGLR KR T+ TQ LIKEQ++E NC EVGP Sbjct: 591 KKLLRHRISNMPLGLKFFRASLGLRKRKKHKKSKRGTVGTQNLIKEQVMEGNCSLLEVGP 650 Query: 196 STSNASMLVSSDSTKLSKEE 137 STS SM VS ST +++ Sbjct: 651 STSKMSMSVSLISTNSQRKK 670 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 99 MDTAHERLEKRNEQNGDAVAMDRESKKS 16 MD E L KR QN DA MD+ + S Sbjct: 683 MDIVDEEL-KRYNQNSDAAPMDKHIENS 709