BLASTX nr result
ID: Jatropha_contig00004992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004992 (101 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP52005.1| glutamine synthetase family protein [Populus tric... 66 5e-09 ref|XP_002329715.1| predicted protein [Populus trichocarpa] gi|1... 66 5e-09 gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parvif... 66 5e-09 gb|AAP33476.1| cytosolic glutamine synthetase [Securigera parvif... 66 5e-09 dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] 66 5e-09 gb|ESQ47306.1| hypothetical protein EUTSA_v10027817mg [Eutrema s... 65 7e-09 emb|CAA73064.1| cytosolic glutamine synthetase [Brassica napus] 65 7e-09 emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus] 65 7e-09 emb|CAL07995.1| cytosolic glutamine synthetase [Platanus x aceri... 65 7e-09 gb|ERP46505.1| hypothetical protein POPTR_0799s00200g [Populus t... 65 9e-09 gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] 65 9e-09 emb|CAA63963.1| glutamate synthetase [Lotus japonicus] 65 9e-09 sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytos... 65 9e-09 gb|EOY21435.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 2... 65 1e-08 gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1... 65 1e-08 ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Caps... 65 1e-08 gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum] 64 1e-08 gb|ESR43843.1| hypothetical protein CICLE_v10011785mg [Citrus cl... 64 2e-08 ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic is... 64 2e-08 ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea may... 64 2e-08 >gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa] Length = 348 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLS+TTDKIIAEYIWIGGSGMDLRSKART Sbjct: 8 INLNLSDTTDKIIAEYIWIGGSGMDLRSKART 39 >ref|XP_002329715.1| predicted protein [Populus trichocarpa] gi|118486146|gb|ABK94916.1| unknown [Populus trichocarpa] Length = 356 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLS+TTDKIIAEYIWIGGSGMDLRSKART Sbjct: 8 INLNLSDTTDKIIAEYIWIGGSGMDLRSKART 39 >gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora] Length = 356 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETTDKIIAEYIWIGGSG+DLRSKART Sbjct: 8 INLNLSETTDKIIAEYIWIGGSGLDLRSKART 39 >gb|AAP33476.1| cytosolic glutamine synthetase [Securigera parviflora] Length = 98 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETTDKIIAEYIWIGGSG+DLRSKART Sbjct: 8 INLNLSETTDKIIAEYIWIGGSGLDLRSKART 39 >dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETTDKIIAEYIW+GGSGMD+RSKART Sbjct: 8 INLNLSETTDKIIAEYIWVGGSGMDMRSKART 39 >gb|ESQ47306.1| hypothetical protein EUTSA_v10027817mg [Eutrema salsugineum] Length = 356 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSETTDKIIAEYIW+GGSGMD+RSKART Sbjct: 8 VNLNLSETTDKIIAEYIWVGGSGMDMRSKART 39 >emb|CAA73064.1| cytosolic glutamine synthetase [Brassica napus] Length = 349 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSETTDKIIAEYIW+GGSGMD+RSKART Sbjct: 1 VNLNLSETTDKIIAEYIWVGGSGMDMRSKART 32 >emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus] Length = 356 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSETTDKIIAEYIW+GGSGMD+RSKART Sbjct: 8 VNLNLSETTDKIIAEYIWVGGSGMDMRSKART 39 >emb|CAL07995.1| cytosolic glutamine synthetase [Platanus x acerifolia] Length = 253 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETT+KIIAEYIWIGGSGMDLRSKART Sbjct: 8 INLNLSETTEKIIAEYIWIGGSGMDLRSKART 39 >gb|ERP46505.1| hypothetical protein POPTR_0799s00200g [Populus trichocarpa] Length = 356 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 IN+NLS+TTDKIIAEYIWIGGSGMDLRSKART Sbjct: 8 ININLSDTTDKIIAEYIWIGGSGMDLRSKART 39 >gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] Length = 356 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLS+TTDKIIAEYIWIGGSGMD+RSKART Sbjct: 8 INLNLSDTTDKIIAEYIWIGGSGMDMRSKART 39 >emb|CAA63963.1| glutamate synthetase [Lotus japonicus] Length = 356 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETTDKIIAEYIWIGGSG+D+RSKART Sbjct: 8 INLNLSETTDKIIAEYIWIGGSGLDMRSKART 39 >sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: Full=GS1; AltName: Full=Glutamate--ammonia ligase Length = 356 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLSETTDKIIAEYIWIGGSG+D+RSKART Sbjct: 8 INLNLSETTDKIIAEYIWIGGSGLDMRSKART 39 >gb|EOY21435.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 2 [Theobroma cacao] Length = 257 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSETT+K+IAEYIWIGGSGMDLRSKART Sbjct: 8 VNLNLSETTEKVIAEYIWIGGSGMDLRSKART 39 >gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma cacao] Length = 356 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSETT+K+IAEYIWIGGSGMDLRSKART Sbjct: 8 VNLNLSETTEKVIAEYIWIGGSGMDLRSKART 39 >ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella] gi|482552713|gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella] Length = 356 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLS+TTDKIIAEYIW+GGSGMD+RSKART Sbjct: 8 INLNLSDTTDKIIAEYIWVGGSGMDMRSKART 39 >gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum] Length = 356 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 INLNLS+TT+KIIAEYIWIGGSGMDLRSKART Sbjct: 8 INLNLSDTTEKIIAEYIWIGGSGMDLRSKART 39 >gb|ESR43843.1| hypothetical protein CICLE_v10011785mg [Citrus clementina] Length = 429 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLSE+TDKIIAEYIWIGGSGMD+RSKART Sbjct: 81 LNLNLSESTDKIIAEYIWIGGSGMDMRSKART 112 >ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Setaria italica] Length = 356 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLS+TT+KIIAEYIWIGGSGMDLRSKART Sbjct: 8 VNLNLSDTTEKIIAEYIWIGGSGMDLRSKART 39 >ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea mays] gi|585204|sp|P38562.1|GLNA4_MAIZE RecName: Full=Glutamine synthetase root isozyme 4; AltName: Full=GS107; AltName: Full=Glutamate--ammonia ligase gi|434330|emb|CAA46722.1| glutamine synthetase [Zea mays] Length = 355 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 5 INLNLSETTDKIIAEYIWIGGSGMDLRSKART 100 +NLNLS+TT+KIIAEYIWIGGSGMDLRSKART Sbjct: 8 VNLNLSDTTEKIIAEYIWIGGSGMDLRSKART 39