BLASTX nr result
ID: Jatropha_contig00004922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004922 (206 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE93847.2| hypothetical protein POPTR_0005s24580g [Populus t... 64 2e-08 ref|XP_002306851.1| predicted protein [Populus trichocarpa] 64 2e-08 >gb|EEE93847.2| hypothetical protein POPTR_0005s24580g [Populus trichocarpa] Length = 461 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 4 PIXS-LGGLYSVMRAMPLDVLMNSYRMSPSEAHQVKRNRDPQSMLFTPT 147 PI S + G SVMRAMP+DV+ N+Y++SP EA Q+K NRDPQSML +PT Sbjct: 409 PIKSPMAGSISVMRAMPIDVISNAYQISPREAEQLKMNRDPQSMLLSPT 457 >ref|XP_002306851.1| predicted protein [Populus trichocarpa] Length = 461 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 4 PIXS-LGGLYSVMRAMPLDVLMNSYRMSPSEAHQVKRNRDPQSMLFTPT 147 PI S + G SVMRAMP+DV+ N+Y++SP EA Q+K NRDPQSML +PT Sbjct: 409 PIKSPMAGSISVMRAMPIDVISNAYQISPREAEQLKMNRDPQSMLLSPT 457