BLASTX nr result
ID: Jatropha_contig00004877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004877 (399 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002892299.1| predicted protein [Arabidopsis lyrata subsp.... 76 2e-21 gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [A... 76 2e-21 ref|NP_563743.2| callose synthase 1 [Arabidopsis thaliana] gi|18... 76 2e-21 ref|NP_001184913.1| callose synthase 1 [Arabidopsis thaliana] gi... 76 2e-21 gb|AAD30609.1|AC007153_1 Highly similar to putative callose synt... 76 2e-21 gb|AAF79729.1|AC005106_10 T25N20.22 [Arabidopsis thaliana] 76 2e-21 dbj|BAF00852.1| putative glucan synthase [Arabidopsis thaliana] 76 2e-21 gb|ESQ51784.1| hypothetical protein EUTSA_v10016125mg [Eutrema s... 76 2e-21 ref|NP_850178.2| glucan synthase-like 3 [Arabidopsis thaliana] g... 76 2e-21 gb|AAD15408.1| putative glucan synthase [Arabidopsis thaliana] 76 2e-21 dbj|BAC42023.1| putative glucan synthase [Arabidopsis thaliana] 76 2e-21 gb|ESQ36366.1| hypothetical protein EUTSA_v10006528mg [Eutrema s... 75 4e-21 gb|ESR59155.1| hypothetical protein CICLE_v10014015mg [Citrus cl... 75 4e-21 gb|ESQ36365.1| hypothetical protein EUTSA_v10006528mg [Eutrema s... 75 4e-21 ref|XP_002283298.2| PREDICTED: callose synthase 3-like [Vitis vi... 73 5e-21 ref|XP_002512182.1| conserved hypothetical protein [Ricinus comm... 74 7e-21 gb|EOY32435.1| Glucan synthase-like 12 isoform 1 [Theobroma caca... 74 9e-21 ref|XP_006354196.1| PREDICTED: callose synthase 3-like isoform X... 74 9e-21 ref|XP_004228593.1| PREDICTED: callose synthase 3-like [Solanum ... 74 9e-21 gb|EOY32439.1| Glucan synthase-like 12 [Theobroma cacao] 74 9e-21 >ref|XP_002892299.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338141|gb|EFH68558.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1955 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1916 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1955 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1891 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1919 >gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [Arabidopsis thaliana] Length = 1950 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1911 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1886 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1914 >ref|NP_563743.2| callose synthase 1 [Arabidopsis thaliana] gi|189081843|sp|Q9AUE0.2|CALS1_ARATH RecName: Full=Callose synthase 1; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 6 gi|332189734|gb|AEE27855.1| callose synthase 1 [Arabidopsis thaliana] Length = 1950 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1911 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1886 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1914 >ref|NP_001184913.1| callose synthase 1 [Arabidopsis thaliana] gi|332189735|gb|AEE27856.1| callose synthase 1 [Arabidopsis thaliana] Length = 1909 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1870 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1909 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1845 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1873 >gb|AAD30609.1|AC007153_1 Highly similar to putative callose synthase catalytic subunit [Arabidopsis thaliana] Length = 1878 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1839 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1878 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1814 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1842 >gb|AAF79729.1|AC005106_10 T25N20.22 [Arabidopsis thaliana] Length = 901 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 862 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 901 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 837 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 865 >dbj|BAF00852.1| putative glucan synthase [Arabidopsis thaliana] Length = 749 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 710 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 749 Score = 51.6 bits (122), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 685 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 713 >gb|ESQ51784.1| hypothetical protein EUTSA_v10016125mg [Eutrema salsugineum] Length = 1950 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1911 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 Score = 51.2 bits (121), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1886 VRTLARGYEILMGLLLFTPVAFLAWFPFV 1914 >ref|NP_850178.2| glucan synthase-like 3 [Arabidopsis thaliana] gi|334184626|ref|NP_001189653.1| glucan synthase-like 3 [Arabidopsis thaliana] gi|357529553|sp|Q9SL03.3|CALS2_ARATH RecName: Full=Callose synthase 2; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 3 gi|330253518|gb|AEC08612.1| glucan synthase-like 3 [Arabidopsis thaliana] gi|330253519|gb|AEC08613.1| glucan synthase-like 3 [Arabidopsis thaliana] Length = 1950 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1911 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 Score = 51.2 bits (121), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1886 VRTLARGYEILMGLLLFTPVAFLAWFPFV 1914 >gb|AAD15408.1| putative glucan synthase [Arabidopsis thaliana] Length = 1510 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 1471 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1510 Score = 51.2 bits (121), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1446 VRTLARGYEILMGLLLFTPVAFLAWFPFV 1474 >dbj|BAC42023.1| putative glucan synthase [Arabidopsis thaliana] Length = 735 Score = 76.3 bits (186), Expect(2) = 2e-21 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNKE Sbjct: 696 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 735 Score = 51.2 bits (121), Expect(2) = 2e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 671 VRTLARGYEILMGLLLFTPVAFLAWFPFV 699 >gb|ESQ36366.1| hypothetical protein EUTSA_v10006528mg [Eutrema salsugineum] Length = 1950 Score = 75.1 bits (183), Expect(2) = 4e-21 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNK+ Sbjct: 1911 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKQ 1950 Score = 51.6 bits (122), Expect(2) = 4e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1886 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1914 >gb|ESR59155.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] Length = 1946 Score = 75.1 bits (183), Expect(2) = 4e-21 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSS+NKE Sbjct: 1907 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1946 Score = 51.6 bits (122), Expect(2) = 4e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1882 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1910 >gb|ESQ36365.1| hypothetical protein EUTSA_v10006528mg [Eutrema salsugineum] Length = 1909 Score = 75.1 bits (183), Expect(2) = 4e-21 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSSKNK+ Sbjct: 1870 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKQ 1909 Score = 51.6 bits (122), Expect(2) = 4e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1845 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1873 >ref|XP_002283298.2| PREDICTED: callose synthase 3-like [Vitis vinifera] gi|297746400|emb|CBI16456.3| unnamed protein product [Vitis vinifera] Length = 1948 Score = 73.2 bits (178), Expect(2) = 5e-21 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGG RKDRSS+NKE Sbjct: 1909 FPFVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1948 Score = 53.1 bits (126), Expect(2) = 5e-21 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 392 APLRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 A +RTLARGYEIIMGLLLFTP AF AW P V Sbjct: 1882 ASVRTLARGYEIIMGLLLFTPVAFLAWFPFV 1912 >ref|XP_002512182.1| conserved hypothetical protein [Ricinus communis] gi|223548726|gb|EEF50216.1| conserved hypothetical protein [Ricinus communis] Length = 1884 Score = 73.9 bits (180), Expect(2) = 7e-21 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGG RKDRSSKNKE Sbjct: 1845 FPFVSEFQTRMLFNQAFSRGLQISRILGGPRKDRSSKNKE 1884 Score = 52.0 bits (123), Expect(2) = 7e-21 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEIIMGLLLFTP AF AW P V Sbjct: 1820 VRTLARGYEIIMGLLLFTPVAFLAWFPFV 1848 >gb|EOY32435.1| Glucan synthase-like 12 isoform 1 [Theobroma cacao] gi|508785180|gb|EOY32436.1| Glucan synthase-like 12 isoform 1 [Theobroma cacao] Length = 1957 Score = 73.9 bits (180), Expect(2) = 9e-21 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDR+S+NKE Sbjct: 1918 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRTSRNKE 1957 Score = 51.6 bits (122), Expect(2) = 9e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1893 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1921 >ref|XP_006354196.1| PREDICTED: callose synthase 3-like isoform X1 [Solanum tuberosum] gi|565375356|ref|XP_006354197.1| PREDICTED: callose synthase 3-like isoform X2 [Solanum tuberosum] Length = 1948 Score = 73.9 bits (180), Expect(2) = 9e-21 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSS+NK+ Sbjct: 1909 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKD 1948 Score = 51.6 bits (122), Expect(2) = 9e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1884 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1912 >ref|XP_004228593.1| PREDICTED: callose synthase 3-like [Solanum lycopersicum] Length = 1948 Score = 73.9 bits (180), Expect(2) = 9e-21 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDRSS+NK+ Sbjct: 1909 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKD 1948 Score = 51.6 bits (122), Expect(2) = 9e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1884 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1912 >gb|EOY32439.1| Glucan synthase-like 12 [Theobroma cacao] Length = 1599 Score = 73.9 bits (180), Expect(2) = 9e-21 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 310 FPLFSEFQTRILFNQAFSRGLQISRILGGQRKDRSSKNKE 191 FP SEFQTR+LFNQAFSRGLQISRILGGQRKDR+S+NKE Sbjct: 1560 FPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRTSRNKE 1599 Score = 51.6 bits (122), Expect(2) = 9e-21 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 386 LRTLARGYEIIMGLLLFTPCAFWAWVPIV 300 +RTLARGYEI+MGLLLFTP AF AW P V Sbjct: 1535 VRTLARGYEIVMGLLLFTPVAFLAWFPFV 1563