BLASTX nr result
ID: Jatropha_contig00004833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004833 (153 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFJ04522.1| legumin B precursor, partial [Vernicia fordii] 77 2e-12 ref|XP_002524606.1| legumin A precursor, putative [Ricinus commu... 77 2e-12 ref|XP_002524605.1| legumin A precursor, putative [Ricinus commu... 77 3e-12 ref|XP_002524195.1| legumin B precursor, putative [Ricinus commu... 75 7e-12 ref|XP_002524198.1| legumin B precursor, putative [Ricinus commu... 74 2e-11 ref|XP_002532028.1| legumin A precursor, putative [Ricinus commu... 72 6e-11 ref|XP_002307645.1| predicted protein [Populus trichocarpa] 68 1e-09 gb|EEE94641.2| legumin family protein [Populus trichocarpa] 67 2e-09 ref|XP_002524604.1| legumin A precursor, putative [Ricinus commu... 66 5e-09 gb|ESR57077.1| hypothetical protein CICLE_v10023766mg [Citrus cl... 65 7e-09 ref|XP_002300775.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 gb|ABW86979.1| 11S legumin protein [Carya illinoinensis] 56 4e-06 gb|ABW86978.1| 11S legumin protein [Carya illinoinensis] 56 4e-06 gb|ACB55490.1| Pis v 5.0101 allergen 11S globulin precusor [Pist... 55 7e-06 gb|AAW29810.1| seed storage protein [Juglans regia] 55 9e-06 >gb|AFJ04522.1| legumin B precursor, partial [Vernicia fordii] Length = 415 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +1 Query: 10 RPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 R +G+CNNLFCG+DSRL++EAFNID SLARKLQSE+D+RGSI+ VE Sbjct: 143 RKRQQGSCNNLFCGIDSRLLAEAFNIDLSLARKLQSESDFRGSIVRVE 190 >ref|XP_002524606.1| legumin A precursor, putative [Ricinus communis] gi|223536159|gb|EEF37814.1| legumin A precursor, putative [Ricinus communis] Length = 478 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +1 Query: 22 RGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 RG CNN+FCG+DSRLI+EAFNI+E LARKLQSEND+RG+I+ VE Sbjct: 215 RGPCNNVFCGMDSRLIAEAFNINEQLARKLQSENDFRGNIVRVE 258 >ref|XP_002524605.1| legumin A precursor, putative [Ricinus communis] gi|223536158|gb|EEF37813.1| legumin A precursor, putative [Ricinus communis] Length = 508 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +1 Query: 22 RGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 RG+CNN+FCG+DSRLI+EAFNI+E LARKLQSEND+RG+I+ VE Sbjct: 245 RGSCNNVFCGMDSRLIAEAFNINEQLARKLQSENDFRGNIVWVE 288 >ref|XP_002524195.1| legumin B precursor, putative [Ricinus communis] gi|223536564|gb|EEF38210.1| legumin B precursor, putative [Ricinus communis] Length = 476 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = +1 Query: 28 TCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 +CNNLFCG+DSR+++EAFN+DE LARKLQ +ND+RGSI+NVE Sbjct: 217 SCNNLFCGIDSRVLAEAFNVDEQLARKLQGQNDFRGSIVNVE 258 >ref|XP_002524198.1| legumin B precursor, putative [Ricinus communis] gi|8118510|gb|AAF73007.1|AF262998_1 legumin-like protein [Ricinus communis] gi|223536567|gb|EEF38213.1| legumin B precursor, putative [Ricinus communis] Length = 476 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/42 (71%), Positives = 40/42 (95%) Frame = +1 Query: 28 TCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 +CNNLFCG+DSR+++EAFN+DE LARKLQ ++D+RGSI+NVE Sbjct: 217 SCNNLFCGIDSRVLAEAFNVDEQLARKLQGQSDFRGSIVNVE 258 >ref|XP_002532028.1| legumin A precursor, putative [Ricinus communis] gi|223528298|gb|EEF30344.1| legumin A precursor, putative [Ricinus communis] Length = 461 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +1 Query: 22 RGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 +G+C NLFCG+D+RLISE+FNIDE LA KLQ +ND+RGSI+ VE Sbjct: 206 QGSCRNLFCGIDTRLISESFNIDEQLATKLQGQNDFRGSIVKVE 249 >ref|XP_002307645.1| predicted protein [Populus trichocarpa] Length = 480 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = +1 Query: 7 FRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 FR G+ CNN+FCG+D+R ++EAFN+ E +ARKLQSE+D RG+I+ V+ Sbjct: 219 FRGHGQQQCNNIFCGMDTRFLAEAFNVSEQVARKLQSESDRRGNIVRVK 267 >gb|EEE94641.2| legumin family protein [Populus trichocarpa] Length = 479 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/49 (55%), Positives = 40/49 (81%) Frame = +1 Query: 7 FRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 FR G+ CNN+FCG+D+R ++EAFN+ E +A+KLQSE+D RG+I+ V+ Sbjct: 219 FRGHGQQQCNNIFCGMDTRFLAEAFNVSEQVAKKLQSESDRRGNIVRVK 267 >ref|XP_002524604.1| legumin A precursor, putative [Ricinus communis] gi|223536157|gb|EEF37812.1| legumin A precursor, putative [Ricinus communis] Length = 475 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = +1 Query: 28 TCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 +CNN+FCG+DSR I+EAFNIDE LAR++Q ++D RG+I+ VE Sbjct: 218 SCNNVFCGMDSRFIAEAFNIDEQLARRIQGQDDARGNIVRVE 259 >gb|ESR57077.1| hypothetical protein CICLE_v10023766mg [Citrus clementina] Length = 434 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 19 GRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINV 150 G CNN+FCG D+R+++EAFN+DE L R+L+SE DYRG+I+ V Sbjct: 206 GHQQCNNVFCGFDTRILAEAFNVDERLVRRLRSEKDYRGAIVTV 249 >ref|XP_002300775.1| predicted protein [Populus trichocarpa] gi|222842501|gb|EEE80048.1| legumin family protein [Populus trichocarpa] Length = 480 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/49 (53%), Positives = 40/49 (81%) Frame = +1 Query: 7 FRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 +R G+ CNN+FCG+D+R ++EAFNI+E +AR+LQ E+D RG+I+ V+ Sbjct: 218 YRGHGQQQCNNVFCGMDTRFLAEAFNINEQVARRLQGESDRRGNIVRVK 266 >gb|ABW86979.1| 11S legumin protein [Carya illinoinensis] Length = 505 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +1 Query: 4 EFRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 E + R NN+F G D+ +++AFN+D AR+LQSEND+RGSI+ VE Sbjct: 222 EHGEQQRDLGNNVFSGFDAEFLADAFNVDTETARRLQSENDHRGSIVRVE 271 >gb|ABW86978.1| 11S legumin protein [Carya illinoinensis] Length = 505 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +1 Query: 4 EFRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 E + R NN+F G D+ +++AFN+D AR+LQSEND+RGSI+ VE Sbjct: 222 EHGEQQRDLGNNVFSGFDAEFLADAFNVDTETARRLQSENDHRGSIVRVE 271 >gb|ACB55490.1| Pis v 5.0101 allergen 11S globulin precusor [Pistacia vera] Length = 473 Score = 55.5 bits (132), Expect = 7e-06 Identities = 20/48 (41%), Positives = 37/48 (77%) Frame = +1 Query: 10 RPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 R + +CNN+FCG D+++++E F +++SL ++LQ+E D RG+I+ V+ Sbjct: 206 RQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVK 253 >gb|AAW29810.1| seed storage protein [Juglans regia] Length = 507 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +1 Query: 4 EFRPEGRGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDYRGSIINVE 153 E + RG NN+F G D+ +++AFN+D AR+LQSEND+R SI+ VE Sbjct: 221 EHGQQQRGLGNNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVE 270