BLASTX nr result
ID: Jatropha_contig00004813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004813 (178 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004506729.1| PREDICTED: EMB-1 protein-like [Cicer arietinum] 65 7e-09 gb|EOY07150.1| Stress induced protein [Theobroma cacao] 64 1e-08 gb|ADQ91833.1| late embryogenesis abundant protein group 1 prote... 64 2e-08 emb|CAA38374.1| late embryogenesis abundant protein [Gossypium h... 64 3e-08 ref|XP_002530506.1| Late seed maturation protein P8B6, putative ... 64 3e-08 ref|XP_004308941.1| PREDICTED: embryonic abundant protein 1-like... 63 3e-08 gb|AAO33587.1|AF479305_1 putative lea 1 [Arachis hypogaea] 63 3e-08 gb|AAZ20278.1| lea protein 1 [Arachis hypogaea] 63 3e-08 gb|ADQ91831.1| late embryogenesis abundant protein group 1 prote... 63 3e-08 gb|AAY54009.1| LEA protein [Arachis hypogaea] 63 3e-08 gb|AAB39473.1| Em protein [Robinia pseudoacacia] 63 4e-08 gb|ERN05313.1| hypothetical protein AMTR_s00007p00162100 [Ambore... 62 6e-08 prf||1906384B water stress-related protein 62 6e-08 ref|NP_001237186.1| uncharacterized protein LOC100500126 [Glycin... 62 1e-07 ref|XP_002315152.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 gb|AAP97398.1| Em protein [Quercus robur] 62 1e-07 gb|AAB39474.1| Em protein [Robinia pseudoacacia] 61 1e-07 gb|ESQ45332.1| hypothetical protein EUTSA_v10010923mg [Eutrema s... 61 2e-07 ref|XP_006296516.1| hypothetical protein CARUB_v10025705mg [Caps... 60 2e-07 gb|EMJ20904.1| hypothetical protein PRUPE_ppa024075mg [Prunus pe... 60 2e-07 >ref|XP_004506729.1| PREDICTED: EMB-1 protein-like [Cicer arietinum] Length = 98 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q+RQELDE+AR+GETVVPGGTGGKSLEAQEH Sbjct: 1 MASQQNRQELDEKARQGETVVPGGTGGKSLEAQEH 35 >gb|EOY07150.1| Stress induced protein [Theobroma cacao] Length = 174 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = +1 Query: 58 PKRAK--MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 PKRAK M+S Q R+ELD RAR GETVVPGGTGGKSL AQEH Sbjct: 58 PKRAKVIMASQQDREELDARARLGETVVPGGTGGKSLAAQEH 99 >gb|ADQ91833.1| late embryogenesis abundant protein group 1 protein [Arachis hypogaea] Length = 98 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q +QELDERA++GETVVPGGTGGKSLEAQEH Sbjct: 1 MASKQQKQELDERAKQGETVVPGGTGGKSLEAQEH 35 >emb|CAA38374.1| late embryogenesis abundant protein [Gossypium hirsutum] gi|167330|gb|AAA33057.1| embryogensis abundant protein [Gossypium hirsutum] gi|167353|gb|AAB00728.1| water-stress protectant protein [Gossypium hirsutum] gi|167355|gb|AAA33064.1| late embryogenesis-abundant protein 2-D [Gossypium hirsutum] Length = 110 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q RQELD RAR+GETV+PGGTGGKSLEAQEH Sbjct: 1 MASQQERQELDARARQGETVIPGGTGGKSLEAQEH 35 >ref|XP_002530506.1| Late seed maturation protein P8B6, putative [Ricinus communis] gi|223529963|gb|EEF31890.1| Late seed maturation protein P8B6, putative [Ricinus communis] Length = 112 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 MSS+Q R ELD RA+RGETVVPGGTGGKSLEAQEH Sbjct: 1 MSSDQERAELDARAKRGETVVPGGTGGKSLEAQEH 35 >ref|XP_004308941.1| PREDICTED: embryonic abundant protein 1-like [Fragaria vesca subsp. vesca] Length = 94 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q R ELDERARRGETV+PGGTGGKSL AQEH Sbjct: 1 MASQQKRAELDERARRGETVIPGGTGGKSLRAQEH 35 >gb|AAO33587.1|AF479305_1 putative lea 1 [Arachis hypogaea] Length = 95 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+RQELDERA++GETVVPGGTGGKSLEAQEH Sbjct: 3 SKQQNRQELDERAKQGETVVPGGTGGKSLEAQEH 36 >gb|AAZ20278.1| lea protein 1 [Arachis hypogaea] Length = 91 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+RQELDERA++GETVVPGGTGGKSLEAQEH Sbjct: 3 SKQQNRQELDERAKQGETVVPGGTGGKSLEAQEH 36 >gb|ADQ91831.1| late embryogenesis abundant protein group 1 protein [Arachis hypogaea] Length = 96 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+RQELDERA++GETVVPGGTGGKSLEAQEH Sbjct: 3 SKQQNRQELDERAKQGETVVPGGTGGKSLEAQEH 36 >gb|AAY54009.1| LEA protein [Arachis hypogaea] Length = 95 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+RQELDERA++GETVVPGGTGGKSLEAQEH Sbjct: 2 SKQQNRQELDERAKQGETVVPGGTGGKSLEAQEH 35 >gb|AAB39473.1| Em protein [Robinia pseudoacacia] Length = 112 Score = 62.8 bits (151), Expect = 4e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+R+ELDERAR GETVVPGGTGGKSLEAQEH Sbjct: 3 SQQQNREELDERARHGETVVPGGTGGKSLEAQEH 36 >gb|ERN05313.1| hypothetical protein AMTR_s00007p00162100 [Amborella trichopoda] Length = 94 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M++ Q R+ELDE+AR+GETVVPGGTGGKSLEAQEH Sbjct: 1 MTTRQERRELDEKARQGETVVPGGTGGKSLEAQEH 35 >prf||1906384B water stress-related protein Length = 110 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q RQ+LD RAR+GETV+PGGTGGKSLEAQEH Sbjct: 1 MASQQERQQLDARARQGETVIPGGTGGKSLEAQEH 35 >ref|NP_001237186.1| uncharacterized protein LOC100500126 [Glycine max] gi|255629381|gb|ACU15035.1| unknown [Glycine max] Length = 101 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q++QELDERAR+GETVVPGGTGGKSLEAQ+H Sbjct: 3 SHQQNKQELDERARQGETVVPGGTGGKSLEAQQH 36 >ref|XP_002315152.1| predicted protein [Populus trichocarpa] gi|222864192|gb|EEF01323.1| Em-like protein GEA6 [Populus trichocarpa] Length = 93 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/36 (83%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 73 MSSNQS-RQELDERARRGETVVPGGTGGKSLEAQEH 177 MSSNQ R+ELD RARRGETV+PGGTGG+SLEAQEH Sbjct: 1 MSSNQQLREELDARARRGETVIPGGTGGRSLEAQEH 36 >gb|AAP97398.1| Em protein [Quercus robur] Length = 113 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q R ELD RAR+GETV+PGGTGGKSLEAQEH Sbjct: 1 MASGQERSELDPRARQGETVIPGGTGGKSLEAQEH 35 >gb|AAB39474.1| Em protein [Robinia pseudoacacia] Length = 99 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S Q+R+ELDE+AR GETVVPGGTGGKSLEAQEH Sbjct: 3 SRQQNREELDEKARHGETVVPGGTGGKSLEAQEH 36 >gb|ESQ45332.1| hypothetical protein EUTSA_v10010923mg [Eutrema salsugineum] Length = 212 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 76 SSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 S QSR+ELDE AR+GETVVPGGTGGKS+EAQEH Sbjct: 3 SKQQSREELDEMARQGETVVPGGTGGKSVEAQEH 36 >ref|XP_006296516.1| hypothetical protein CARUB_v10025705mg [Capsella rubella] gi|482565224|gb|EOA29414.1| hypothetical protein CARUB_v10025705mg [Capsella rubella] Length = 92 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 M+S Q +++LDERA++GETVVPGGTGGKSLEAQ+H Sbjct: 1 MASQQEKKQLDERAKKGETVVPGGTGGKSLEAQQH 35 >gb|EMJ20904.1| hypothetical protein PRUPE_ppa024075mg [Prunus persica] Length = 95 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 73 MSSNQSRQELDERARRGETVVPGGTGGKSLEAQEH 177 MSS Q R ELD RAR+G+TVVPGGTGGK+LEAQEH Sbjct: 1 MSSQQERAELDARARQGQTVVPGGTGGKTLEAQEH 35