BLASTX nr result
ID: Jatropha_contig00004799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004799 (412 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR66955.1| hypothetical protein CICLE_v10007342mg [Citrus cl... 70 3e-10 gb|EOY33420.1| Ribosomal protein S5/Elongation factor G/III/V fa... 70 3e-10 emb|CBI25589.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002267199.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 70 3e-10 gb|EMJ18344.1| hypothetical protein PRUPE_ppa000830mg [Prunus pe... 69 6e-10 ref|XP_004139267.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 69 6e-10 ref|XP_002532501.1| 116 kD U5 small nuclear ribonucleoprotein co... 69 6e-10 gb|ESW27103.1| hypothetical protein PHAVU_003G174100g [Phaseolus... 68 1e-09 ref|XP_003549705.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 68 1e-09 ref|XP_003542669.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 68 1e-09 ref|XP_004508402.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 67 3e-09 ref|XP_003609507.1| 116 kDa U5 small nuclear ribonucleoprotein c... 67 3e-09 gb|EEF03140.2| elongation factor Tu family protein [Populus tric... 66 5e-09 ref|XP_004307073.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 66 5e-09 ref|XP_002324575.1| predicted protein [Populus trichocarpa] 66 5e-09 gb|AFW87247.1| putative translation elongation factor family pro... 63 3e-08 gb|AFW87246.1| putative translation elongation factor family pro... 63 3e-08 ref|XP_002438662.1| hypothetical protein SORBIDRAFT_10g023820 [S... 63 3e-08 ref|XP_006359523.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 63 4e-08 ref|XP_004242711.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 63 4e-08 >gb|ESR66955.1| hypothetical protein CICLE_v10007342mg [Citrus clementina] Length = 989 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAMVVELAQQAAD+HQQMI Sbjct: 955 RRKGMSEDVSINKFFDEAMVVELAQQAADLHQQMI 989 >gb|EOY33420.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Theobroma cacao] Length = 990 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAMVVELAQQAAD+HQQMI Sbjct: 956 RRKGMSEDVSINKFFDEAMVVELAQQAADLHQQMI 990 >emb|CBI25589.3| unnamed protein product [Vitis vinifera] Length = 931 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAMVVELAQQAAD+HQQMI Sbjct: 897 RRKGMSEDVSINKFFDEAMVVELAQQAADLHQQMI 931 >ref|XP_002267199.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component [Vitis vinifera] gi|147858113|emb|CAN81413.1| hypothetical protein VITISV_031170 [Vitis vinifera] Length = 988 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAMVVELAQQAAD+HQQMI Sbjct: 954 RRKGMSEDVSINKFFDEAMVVELAQQAADLHQQMI 988 >gb|EMJ18344.1| hypothetical protein PRUPE_ppa000830mg [Prunus persica] Length = 988 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQAAD+HQQMI Sbjct: 954 RRKGMSEDVSINKFFDEAMMVELAQQAADLHQQMI 988 >ref|XP_004139267.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Cucumis sativus] gi|449493675|ref|XP_004159406.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Cucumis sativus] Length = 988 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQAAD+HQQMI Sbjct: 954 RRKGMSEDVSINKFFDEAMMVELAQQAADLHQQMI 988 >ref|XP_002532501.1| 116 kD U5 small nuclear ribonucleoprotein component, putative [Ricinus communis] gi|223527776|gb|EEF29877.1| 116 kD U5 small nuclear ribonucleoprotein component, putative [Ricinus communis] Length = 992 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAMVVELA QAADIHQQMI Sbjct: 958 RRKGMSEDVSINKFFDEAMVVELAHQAADIHQQMI 992 >gb|ESW27103.1| hypothetical protein PHAVU_003G174100g [Phaseolus vulgaris] Length = 986 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQAAD+HQQM+ Sbjct: 952 RRKGMSEDVSINKFFDEAMMVELAQQAADLHQQMM 986 >ref|XP_003549705.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Glycine max] Length = 988 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQAAD+HQQM+ Sbjct: 954 RRKGMSEDVSINKFFDEAMMVELAQQAADLHQQMM 988 >ref|XP_003542669.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Glycine max] Length = 986 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQAAD+HQQM+ Sbjct: 952 RRKGMSEDVSINKFFDEAMMVELAQQAADLHQQMM 986 >ref|XP_004508402.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Cicer arietinum] Length = 990 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSI KFFDEAM+VELAQQAAD+HQQMI Sbjct: 956 RRKGMSEDVSIGKFFDEAMMVELAQQAADLHQQMI 990 >ref|XP_003609507.1| 116 kDa U5 small nuclear ribonucleoprotein component [Medicago truncatula] gi|355510562|gb|AES91704.1| 116 kDa U5 small nuclear ribonucleoprotein component [Medicago truncatula] Length = 983 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSI KFFDEAM+VELAQQAAD+HQQMI Sbjct: 949 RRKGMSEDVSIGKFFDEAMMVELAQQAADLHQQMI 983 >gb|EEF03140.2| elongation factor Tu family protein [Populus trichocarpa] Length = 869 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 406 KGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 KGMSEDVSINKFFDEAMVVELAQQAADIHQQM+ Sbjct: 837 KGMSEDVSINKFFDEAMVVELAQQAADIHQQMM 869 >ref|XP_004307073.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Fragaria vesca subsp. vesca] Length = 985 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSI+KFFDEAM+VELAQQ ADIHQQMI Sbjct: 951 RRKGMSEDVSISKFFDEAMMVELAQQEADIHQQMI 985 >ref|XP_002324575.1| predicted protein [Populus trichocarpa] Length = 869 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 406 KGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 KGMSEDVSINKFFDEAMVVELAQQAADIHQQM+ Sbjct: 837 KGMSEDVSINKFFDEAMVVELAQQAADIHQQMM 869 >gb|AFW87247.1| putative translation elongation factor family protein [Zea mays] Length = 302 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+ ELAQQAADIH QM+ Sbjct: 268 RRKGMSEDVSINKFFDEAMMNELAQQAADIHLQMM 302 >gb|AFW87246.1| putative translation elongation factor family protein [Zea mays] Length = 371 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+ ELAQQAADIH QM+ Sbjct: 337 RRKGMSEDVSINKFFDEAMMNELAQQAADIHLQMM 371 >ref|XP_002438662.1| hypothetical protein SORBIDRAFT_10g023820 [Sorghum bicolor] gi|241916885|gb|EER90029.1| hypothetical protein SORBIDRAFT_10g023820 [Sorghum bicolor] Length = 995 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+ ELAQQAADIH QM+ Sbjct: 961 RRKGMSEDVSINKFFDEAMMNELAQQAADIHLQMM 995 >ref|XP_006359523.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform X1 [Solanum tuberosum] gi|565387474|ref|XP_006359524.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform X2 [Solanum tuberosum] Length = 987 Score = 62.8 bits (151), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQ AD+H QM+ Sbjct: 953 RRKGMSEDVSINKFFDEAMMVELAQQDADLHLQMM 987 >ref|XP_004242711.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Solanum lycopersicum] Length = 987 Score = 62.8 bits (151), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 412 RRKGMSEDVSINKFFDEAMVVELAQQAADIHQQMI 308 RRKGMSEDVSINKFFDEAM+VELAQQ AD+H QM+ Sbjct: 953 RRKGMSEDVSINKFFDEAMMVELAQQDADLHLQMM 987