BLASTX nr result
ID: Jatropha_contig00004798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004798 (413 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517584.1| Late embryogenesis abundant protein D-7, put... 58 1e-06 >ref|XP_002517584.1| Late embryogenesis abundant protein D-7, putative [Ricinus communis] gi|223543216|gb|EEF44748.1| Late embryogenesis abundant protein D-7, putative [Ricinus communis] Length = 130 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -3 Query: 411 GVLEETGEKMKHAAQKTADTVKSAFGMAHHEEEEDHVKDRSGH 283 GV+++TG+K+K+ AQKTADTVKSAFGMAH+ E+ KD++GH Sbjct: 81 GVVQQTGDKVKNMAQKTADTVKSAFGMAHNGED----KDKAGH 119